KEGG   Azoarcus sp. BH72: azo1666Help
Entry
azo1666           CDS       T00441                                 

Gene name
tesA1
Definition
acyl-CoA thioesterase (EC:3.1.2.20)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
azo  Azoarcus sp. BH72
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    azo1666 (tesA1)
Enzymes [BR:azo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     azo1666 (tesA1)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     azo1666 (tesA1)
Lipid biosynthesis proteins [BR:azo01004]
 Fatty acid synthase
  Component type
   azo1666 (tesA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1829378..1829989)
Genome map
AA seq 203 aa AA seqDB search
MPLRSIVTLLFIMLSGAAQAATILVWGDSLSAGYGLKNGEAWPTLLQTRLAREGFRHTVV
NDSVSGETSAGGRSRLPAALARHKPDILILELGANDGLRGLQPAVLAENLGAMIDTAHKA
GAKVLLVGMRMPPNYGTSYTTRFEAAFADVARERKVRLVPFLFDGFADKPELFQADGIHP
AADAQQLMLDTLWRSGLRDMLKG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgcgatccatcgtcaccctgctgttcatcatgttgtcgggcgccgcgcaggcc
gccaccatcctggtgtggggtgacagcctctcggccggctatggcctgaagaacggagag
gcctggcccaccctgctgcagacgcgccttgcccgcgaagggttccgccacacggtcgtc
aacgacagcgtgtcgggcgagacctcggccggcgggcgctcccggctgccggccgcgctc
gcgcgccacaagccggacatcctgatcctcgaactcggcgccaacgacggcttgcgcggt
ctgcagcccgccgtgctggcggaaaacctgggcgcgatgatcgacaccgcgcacaaggcc
ggcgccaaggtgctgctggtgggcatgcgcatgccgccgaactacggcacaagctacacc
acccgcttcgaagcagcctttgccgacgtcgcgcgcgagcgcaaggtgcggctggtgcct
ttcctgttcgacggctttgccgacaagccggagcttttccaggccgacggcatccacccg
gccgccgacgcgcagcagctgatgctcgacaccctgtggcgcagcggcctgcgcgacatg
ctcaagggctga

DBGET integrated database retrieval system