KEGG   Azoarcus sp. BH72: azo1741Help
Entry
azo1741           CDS       T00441                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
azo  Azoarcus sp. BH72
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:azo00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    azo1741
Enzymes [BR:azo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     azo1741
DNA repair and recombination proteins [BR:azo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     azo1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
1908782..1911427
Genome map
AA seq 881 aa AA seqDB search
MKAHDKRRDEARGMKPGAIAALAEYARKRDFSITAEPPVRGARPRAEGALGFVVQKHAAR
RLHYDFRLELDGTLKSWAIPKGPSLDPRVKRLAVHVEDHPLDYADFEGRIPQGQYGGGDV
IVWDRGLWQPRDPDPAAAYRAGKLSFHLLGEKLSGGWTLVRTRDGGSGDKAQWLLIKDAD
GAARPQSDYDVVVARPESVLTHAQLPARRDAAGAAGGEGAKKARVAALRGDAARNPAWIA
PELATAVEAPPPGEWRYELKFDGYRMLARVENGRARLYTRNHHDWTAKLAPLREAVESLG
ADSAWLDGEVVVTDAQGVPDFQALQNALELGRDADLRYFLFDLPYLDGEDLRKLPLEARR
ARLRALLGAHDHPRLAYSEDFPVPPQDILASACELRIEGVIGKRAGSPYRSVRSTDWIKL
KCRQRQEFVIVGYSAPQGGRQGFGALLLAVHDEAAGGRLRYAGKVGSGFSGASLKALHQR
MQPLRRPTPALALPVDSSVTRGATWLEPRLLCEVAFAMWTRDGLVRHAVFQGLRDDKPAA
DAVRERALPATAVARIQGDGRDDEDAPAPTAKVPSNGVRAGARRSPGTLAGVAISNPDRV
IDAASGVTKGELATFYCRIGAQLLPHLAGRPLSILRAPTGIDGERFFQRHADKMSMAGVH
LLPPDLDPDGERLMMVDTLEGVVGAAQMGTIEFHTWNATADRIERPDRIVFDLDPDPALP
WSRMVEATRLVLTLLDEIGLDAFLKTSGGKGIHVVVPLARRHDWEALKQFSRAVTRHLAR
ILPQRFADRMGPQNRVGRIFVDYLRNQRAASTVSAYSVRARPGLAVSVPITRQELERIDG
ADQWTVRNLHERLARLTRDPWEGYANRQVISAAMRAAVAAD
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcacacgacaaacgccgcgatgaagcgcgcggcatgaagccgggcgcgatcgcc
gctttggcggaatacgcccgcaagcgcgacttctcgatcaccgcggagccgccggtgcgc
ggcgcgcggccgcgcgccgagggcgccctcggcttcgtcgtgcagaagcatgccgcgcgc
cgcctgcactacgacttccgcctggaactcgacggcacgctgaagagctgggcgatcccc
aaggggccgagcctggacccgcgggtcaagcgcctggcggtgcacgtcgaagaccatccg
ctcgactacgccgacttcgagggccgcattccgcagggccagtacggcggcggcgacgtc
atcgtgtgggaccgcgggttgtggcagccgcgcgaccccgatcccgcggcggcctaccgc
gccggcaagctcagcttccacctgcttggcgaaaagctctccggcggctggaccctggtt
cgcacccgcgacggcggcagcggcgacaaggcgcaatggctgctgatcaaggatgcggac
ggcgctgcgcggccgcagtcggactacgacgtggtcgtcgcacggcccgagagcgtattg
acccacgctcaactgccagcgcggcgcgatgccgccggcgcggcgggcggcgagggcgcg
aagaaggcccgcgtggcagcgttgcgcggcgacgcggcacgcaatccggcctggatcgcg
ccggaactcgccaccgcggtggaggcgccaccgccgggcgaatggcgctacgaactcaag
ttcgatggctaccgcatgctcgcacgggtggaaaacggccgcgcgcggctctacacccgc
aaccatcacgactggaccgcaaaactggcaccgctgcgcgaggcggtggaaagcctgggt
gcggacagcgcctggctggacggcgaggtggtggtgaccgacgcccagggcgtgcccgat
ttccaggccctgcagaacgcgctggagctggggcgtgacgcggacctgcgctatttcctg
ttcgacctgccctacctggacggcgaagacctgcgcaagctgccgctggaagcgcgccga
gcccgcctgcgcgcactgctgggcgcgcacgaccatccgcggctggcgtattcggaggac
tttccggtgccgccgcaggacatcctcgccagcgcctgcgaattgcgcatcgagggcgtc
atcggcaagcgcgccggcagcccctaccgttcggtccgcagcaccgactggatcaagctc
aaatgccgccagcggcaggagttcgtgatcgtcggctacagcgcaccgcagggcgggcgc
caggggtttggcgccttgctgctggcggtgcacgacgaagccgcgggcgggcgcctgcgc
tacgccggcaaggtcggcagcggtttcagcggcgccagcctgaaggccttgcaccagcgc
atgcagccactgcgccgcccgaccccggcgctggcgctgccggtcgatagcagcgtcacc
cgcggcgccacctggctggagccgcgcctgctgtgcgaggtggcgtttgcgatgtggacc
cgcgacgggctggtgcgccatgcggtgttccagggcctgcgcgacgacaaacccgccgcc
gacgcggtgcgcgagcgcgcattgcccgccaccgccgtggcacgcattcaaggtgacgga
cgcgatgacgaagacgcgccggcgccgaccgccaaggtgccgtcgaacggcgtccgcgcc
ggcgcgaggcgcagtcccggcacgctcgcgggcgttgcgatcagcaacccggaccgcgtc
atcgacgccgccagcggcgtgaccaagggcgaactcgccaccttctactgccgcatcggc
gcgcagctgctgccccatctggcggggcggccgctgtccatcctgcgcgcgcccaccggc
atcgacggcgaacgcttcttccagcgccatgccgacaagatgtcgatggcgggcgtgcat
ctgctaccgcccgacctcgacccggacggcgagcgcctgatgatggtggatacgctggag
ggcgtggtcggcgcggcgcagatgggcacgatcgagttccacacctggaatgccaccgcc
gaccgcatcgagcgccccgaccgcatcgtgttcgacctcgaccccgaccccgcgctgccg
tggtcgcgcatggtggaggcgacccggctggtgctgacgctgctggacgaaatcggactg
gatgccttcctgaagaccagcggcggcaagggcatccacgtggtggtgccgctcgcgcgg
cggcacgactgggaggcgctgaagcagttctcgcgcgcggtcacccggcatctggcgcgc
atcctgcctcagcgctttgcggaccgcatggggccgcagaaccgggtagggcgcatcttc
gttgactacctgcgcaaccagcgcgcggcgagcacggtgtcggcctattcggtgcgtgcg
cgccccgggctggcggtgtcggtgccgatcacccgccaggagctggagcgcatcgacggc
gccgaccaatggacggtgcgcaacctgcacgagcggctggcgcggctcacccgcgaccca
tgggagggctacgccaaccgccaggtgatcagcgccgcgatgcgggccgcggtggcggcg
gactga

DBGET integrated database retrieval system