KEGG   Azoarcus sp. BH72: azo1772Help
Entry
azo1772           CDS       T00441                                 

Gene name
cioB
Definition
(GenBank) probable cyanide insensitive terminal oxidase,subunit II
  KO
K00426  
cytochrome d ubiquinol oxidase subunit II [EC:1.10.3.14]
Organism
azo  Azoarcus sp. BH72
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome d ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    azo1772 (cioB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    azo1772 (cioB)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     azo1772 (cioB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
1940316..1941338
Genome map
AA seq 340 aa AA seqDB search
MPDLSQPAGWLPLVFLLVMGLAILVYVVLDGYDLGLGILLGFADDAEKDIMVASIGPFWD
ANETWLVLGIGVLLTAFPLAHGVIMGALYLPVAAMLAGLILRGVAFDFRVKAEAHHKPWW
NRAFCAGSLLAALSQGYMLGLLVVGFERTTIHVLFAAFIGLCLAAGYVLLGAGWLLIKTE
GALQQRAARWAGAALWFTAFGIAAVSVATPLLSRAIFDKWFAIPNLFLLAPIPLITATLF
GLSALVLARLPAQLERGNQAWTWVPFAAAVGVFILAFHGLAYSLFPWIVPQRMDLWQAAA
APGSLLFILVGVVTVLPMIIAYTVFAYRVFWGKATDLEYG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatctctcccaacccgccggctggctgccgctggtgttcctgctggtgatgggg
ctggcgatcctggtgtacgtggtgctggacggctacgaccttggcctcggcatcctgctc
ggcttcgccgacgacgccgagaaggacatcatggtggcgtcgatcggccccttctgggac
gccaacgaaacctggctggtgctcggcatcggtgtgctgctgaccgctttcccgctcgcg
cacggcgtcatcatgggcgcgctctacctgccggtggccgcgatgctcgccgggctgatc
ctgcgcggggtcgcgttcgatttccgggtgaaggccgaggcgcaccacaagccgtggtgg
aaccgcgcgttctgcgccggctcgctgctggcggcgctgtcgcagggctacatgctgggg
ttgctggtggtgggctttgagcgcaccaccatccatgtgctgttcgccgccttcatcggc
ctgtgccttgccgccggctacgtgctgctgggcgcgggctggctgctgatcaagaccgaa
ggcgccttgcagcagcgcgccgcgcgctgggcaggcgccgcgctgtggtttaccgccttc
ggcatcgccgcggtgtctgtggcgacgccgctgctcagccgcgcgatcttcgacaagtgg
ttcgcgattcccaacctcttcctgctggcgccgatcccgctgatcaccgccacgctgttc
ggcctttccgcgctggtgctggcccgtttgccggcgcagttggagcgcggcaatcaggcc
tggacctgggtgcccttcgccgccgccgtgggcgtcttcatcctcgccttccacggcctt
gcctacagcctgtttccttggatcgtgccgcagcgcatggacctgtggcaggccgccgcc
gcgcccggctcgctgttgttcatcctggtcggcgtggtcaccgtgctgcccatgatcatc
gcctacaccgtgtttgcctaccgggtgttctggggcaaggcgacggatctggaatacggt
tga

DBGET integrated database retrieval system