KEGG   Azoarcus sp. BH72: azo1796Help
Entry
azo1796           CDS       T00441                                 

Gene name
glgB2
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
azo  Azoarcus sp. BH72
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    azo1796 (glgB2)
Enzymes [BR:azo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     azo1796 (glgB2)
Exosome [BR:azo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   azo1796 (glgB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1965782..1967599
Genome map
AA seq 605 aa AA seqDB search
MNGPDFAPPGPAPTGCRHYAGMGARPVTVDGLAGTRFRVWAPHARAVAVALAPGNERAAL
YAGADGLWEGFVPGVGHGDSYAFRIESARGEVLAKADPYASACELPPGIGSRVWDLAYRW
WDADWMRARAGRRAADAPLSIYEVHLGSWRAAEAGERFAGYRRSADELAPYLMRLGFTHV
ELMPLVEHGDYGDWGYRSGSRFAPSARYGTPQDLMYLVDRLHQAGLGVILDWVPASFPAE
SHGLVRFDGTPLYEGGRARAEGDEIAFDLTDDAVGAFLIDSALYWLDTYHIDGLRLSGVD
RLLRGQPGADDFLRRLTRCIHAEHPGVMVIAEADEADEALRTALTRPEAVGGYGCDLAWN
LAWVHDALDYFVRDPGQRHYHQGKLMDAAAGAAAARSVLPLAHAEVVYGRRALLEKQRGD
SWQKRASLRALFGLMWAFPGRKLLFMGGELGVACEWDPRGCLDWSLENTPANAAIQRWVA
DLNHHYRAHPALHAGDAAPGGLEWVAANDASDSVLAFLRRPAREEEPTLLVACNLTLLPR
FDHALGVSRGGWWTELLNSDAEAYGGSGLGNQGGLAAQEVDWHGQRHALALTLPPLSVVF
LESPR
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgaacggccccgacttcgcgccccccggcccagcgcccaccggctgccgccactacgcc
ggcatgggcgcgcgcccggtgacggtggacgggctggccggcacgcgctttcgcgtatgg
gcgccgcacgcgcgtgcggtggcggtggcgctggcgcccggcaacgagcgcgccgcgctg
tatgcgggcgccgacggcctgtgggaaggcttcgtgcccggcgtcggccacggcgacagc
tacgccttccgcatcgagagcgcacgcggcgaggtgctcgcgaaggccgacccctatgcc
agcgcgtgcgaactgccgcccggcatcggctcgcgggtgtgggacctcgcctaccgctgg
tgggacgccgactggatgcgcgcccgcgccgggcgacgggcggccgacgcgccgctgtcg
atctacgaggtgcatctcggctcctggcgcgcggccgaggcgggcgagcgcttcgccggc
taccgccgcagcgccgacgaactggcgccctacctgatgcggctgggtttcacccatgtg
gagctgatgccgctggtggagcacggcgactacggcgactggggctaccgcagcggcagc
cgctttgcgccgagcgcgcgctacggcacgccgcaggacctgatgtacctggtcgaccgc
ctgcatcaggccgggctgggcgtgatcctcgactgggtgccggcgagttttccggcggag
tcgcacgggctggtgcgcttcgacggcacgccgctgtacgagggcggccgcgcccgcgcc
gagggcgacgagatcgctttcgacctcactgatgacgcggtcggcgccttcctgatcgac
agcgcgctgtactggctggacacctaccacatcgacggcctgcggctgtccggcgtggat
cgcctgctgcgcgggcagccgggcgccgacgacttcctgcgccggctgacgcgctgcatc
catgccgaacacccgggcgtgatggtgatcgccgaggcggacgaggccgacgaggccttg
cgcaccgcgctgacccgccccgaggccgtgggcggctatggctgcgacctcgcctggaac
ctggcgtgggtgcacgacgcgctcgactacttcgtgcgcgaccccggccagcgccactac
caccagggcaagctgatggacgccgcggccggcgcggccgcggcgcgctcggtgctgccg
ctggcgcacgccgaggtggtgtatggacgccgcgcgctgctggaaaagcagcgcggcgac
tcgtggcagaaacgcgccagcctgcgcgcgctgttcggcctgatgtgggcttttccgggc
cgcaagctgctgttcatgggcggcgaactcggcgttgcctgcgagtgggacccgcgcggc
tgcctcgactggtcgctggaaaacacgccggccaacgccgccatccagcgctgggtggcc
gacctcaaccatcactaccgcgctcacccggcgctgcatgccggcgatgccgcgcccggc
gggctggagtgggtggcggcgaacgacgccagcgacagcgtgctcgccttcctgcgccgg
ccggcgcgcgaagaggagccgacgctgctggtggcctgcaacctgaccctgctgccgcgc
ttcgaccacgcgctgggcgtgtcgcgcgggggctggtggaccgagttgctgaacagcgac
gccgaagcctacggcggcagcggactcggcaatcagggcgggctggctgcccaggaggtg
gattggcacggccagcgccacgccctcgcgctgacccttccaccgctgtcggtggtgttt
ctggagagcccgcgatga

DBGET integrated database retrieval system