KEGG   Azoarcus sp. BH72: azo1796Help
Entry
azo1796           CDS       T00441                                 

Gene name
glgB2
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
azo  Azoarcus sp. BH72
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:azo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1965782..1967599
Genome map
AA seq 605 aa AA seqDB search
MNGPDFAPPGPAPTGCRHYAGMGARPVTVDGLAGTRFRVWAPHARAVAVALAPGNERAAL
YAGADGLWEGFVPGVGHGDSYAFRIESARGEVLAKADPYASACELPPGIGSRVWDLAYRW
WDADWMRARAGRRAADAPLSIYEVHLGSWRAAEAGERFAGYRRSADELAPYLMRLGFTHV
ELMPLVEHGDYGDWGYRSGSRFAPSARYGTPQDLMYLVDRLHQAGLGVILDWVPASFPAE
SHGLVRFDGTPLYEGGRARAEGDEIAFDLTDDAVGAFLIDSALYWLDTYHIDGLRLSGVD
RLLRGQPGADDFLRRLTRCIHAEHPGVMVIAEADEADEALRTALTRPEAVGGYGCDLAWN
LAWVHDALDYFVRDPGQRHYHQGKLMDAAAGAAAARSVLPLAHAEVVYGRRALLEKQRGD
SWQKRASLRALFGLMWAFPGRKLLFMGGELGVACEWDPRGCLDWSLENTPANAAIQRWVA
DLNHHYRAHPALHAGDAAPGGLEWVAANDASDSVLAFLRRPAREEEPTLLVACNLTLLPR
FDHALGVSRGGWWTELLNSDAEAYGGSGLGNQGGLAAQEVDWHGQRHALALTLPPLSVVF
LESPR
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgaacggccccgacttcgcgccccccggcccagcgcccaccggctgccgccactacgcc
ggcatgggcgcgcgcccggtgacggtggacgggctggccggcacgcgctttcgcgtatgg
gcgccgcacgcgcgtgcggtggcggtggcgctggcgcccggcaacgagcgcgccgcgctg
tatgcgggcgccgacggcctgtgggaaggcttcgtgcccggcgtcggccacggcgacagc
tacgccttccgcatcgagagcgcacgcggcgaggtgctcgcgaaggccgacccctatgcc
agcgcgtgcgaactgccgcccggcatcggctcgcgggtgtgggacctcgcctaccgctgg
tgggacgccgactggatgcgcgcccgcgccgggcgacgggcggccgacgcgccgctgtcg
atctacgaggtgcatctcggctcctggcgcgcggccgaggcgggcgagcgcttcgccggc
taccgccgcagcgccgacgaactggcgccctacctgatgcggctgggtttcacccatgtg
gagctgatgccgctggtggagcacggcgactacggcgactggggctaccgcagcggcagc
cgctttgcgccgagcgcgcgctacggcacgccgcaggacctgatgtacctggtcgaccgc
ctgcatcaggccgggctgggcgtgatcctcgactgggtgccggcgagttttccggcggag
tcgcacgggctggtgcgcttcgacggcacgccgctgtacgagggcggccgcgcccgcgcc
gagggcgacgagatcgctttcgacctcactgatgacgcggtcggcgccttcctgatcgac
agcgcgctgtactggctggacacctaccacatcgacggcctgcggctgtccggcgtggat
cgcctgctgcgcgggcagccgggcgccgacgacttcctgcgccggctgacgcgctgcatc
catgccgaacacccgggcgtgatggtgatcgccgaggcggacgaggccgacgaggccttg
cgcaccgcgctgacccgccccgaggccgtgggcggctatggctgcgacctcgcctggaac
ctggcgtgggtgcacgacgcgctcgactacttcgtgcgcgaccccggccagcgccactac
caccagggcaagctgatggacgccgcggccggcgcggccgcggcgcgctcggtgctgccg
ctggcgcacgccgaggtggtgtatggacgccgcgcgctgctggaaaagcagcgcggcgac
tcgtggcagaaacgcgccagcctgcgcgcgctgttcggcctgatgtgggcttttccgggc
cgcaagctgctgttcatgggcggcgaactcggcgttgcctgcgagtgggacccgcgcggc
tgcctcgactggtcgctggaaaacacgccggccaacgccgccatccagcgctgggtggcc
gacctcaaccatcactaccgcgctcacccggcgctgcatgccggcgatgccgcgcccggc
gggctggagtgggtggcggcgaacgacgccagcgacagcgtgctcgccttcctgcgccgg
ccggcgcgcgaagaggagccgacgctgctggtggcctgcaacctgaccctgctgccgcgc
ttcgaccacgcgctgggcgtgtcgcgcgggggctggtggaccgagttgctgaacagcgac
gccgaagcctacggcggcagcggactcggcaatcagggcgggctggctgcccaggaggtg
gattggcacggccagcgccacgccctcgcgctgacccttccaccgctgtcggtggtgttt
ctggagagcccgcgatga

DBGET integrated database retrieval system