KEGG   Azoarcus sp. BH72: azo1800Help
Entry
azo1800           CDS       T00441                                 

Gene name
glk1
Definition
putative glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    azo1800 (glk1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo1800 (glk1)
   00052 Galactose metabolism
    azo1800 (glk1)
   00500 Starch and sucrose metabolism
    azo1800 (glk1)
   00520 Amino sugar and nucleotide sugar metabolism
    azo1800 (glk1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    azo1800 (glk1)
   00524 Butirosin and neomycin biosynthesis
    azo1800 (glk1)
Enzymes [BR:azo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     azo1800 (glk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1976211..1977182)
Genome map
AA seq 323 aa AA seqDB search
MILCGDIGATKSLLGLAEARGGAIHIKLVRRYENREWPGFGELVDDFLAEAAAARGEAVE
LTVAGFGIAGPVGPDGVHMTNLDWYIGPGPLRSVLGGAPVRLLNDFEASALGIGDLGGDG
CLPLQPAPALSTAPQLVIGAGSGLGVALRVPTANGVVVVPGEGGHVGYAPRNEEQLALWR
QLRAGSGRLSVEHVVSGPGLGRIYEWLAETRASTGPCGELVWERAVEGNLHARHAIDLFL
DSYGAVAGDFALATLARGGVYLTGGIGPRLLTAPAAAARFLAAFRDKAPHGALMTQMPVH
LVVDDKLPLLGAARAATDLLPTA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgtgcggagacatcggcgccaccaagagcctgctcggcctcgccgaggcacgc
ggcggcgcgatccacatcaagctggtacgacgttacgaaaaccgcgagtggccgggcttc
ggcgaactggtcgacgacttcctggccgaagcggcggccgcgcgcggcgaagcggtggag
ctcaccgtcgccgggttcggcatcgccggcccggtggggccggacggcgtgcatatgacc
aatctcgactggtacatcggcccgggcccgctgcgcagcgtgctgggcggcgcaccggtg
cggctgctcaacgacttcgaggcgagcgcgctcggcatcggcgacctcggcggcgacggt
tgcctgccgctgcagcccgcgcccgcactttccacggcgccacagctggtgataggcgcc
ggctcggggctgggcgtggcgctgcgggtaccgacggcgaacggcgtggtggtggtgccg
ggcgaaggcggccacgtcggctacgcgccgcgcaacgaggagcagctcgcgctgtggcgc
cagctgcgcgccggaagcggccggctgagcgtggagcacgtggtttccggccccggcctc
gggcgcatctacgagtggctggccgagacccgcgcaagtaccggcccctgcggcgaactc
gtatgggagcgggcggtggaaggcaacctgcacgcgcgccacgcgatcgacctgttcctc
gacagctatggcgcggtggcgggcgacttcgccctcgcgacgctggcgcgcggcggggtg
tatctgaccggcggcatcggcccgcggctgctcaccgcgccagccgcggcggcacgcttt
ctcgctgccttccgcgacaaggcgccgcacggcgcgctgatgacgcagatgccggtgcac
ctggtggtggacgacaagctgccgctgctcggcgcagcgcgcgcggccacggatctgctg
ccgaccgcctga

DBGET integrated database retrieval system