KEGG   Azoarcus sp. BH72: azo1856Help
Entry
azo1856           CDS       T00441                                 

Gene name
lapF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
azo  Azoarcus sp. BH72
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:azo00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:azo00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:azo00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:azo00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:azo00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2038548..2039462
Genome map
AA seq 304 aa AA seqDB search
MKKIKCALIGSGNIGTDLIYKIKRSPVLEPVWMVGIDPASEGLARARELGLKTTADGVDG
LLPHVLEDGIQIAFDATSAYVHAENSRKLNELGVMMIDLTPAAIGPLCVPPVNLRQHADR
VEMNVNMISCAGQATIPIVNAVSRVQGVEYAEIVASLASKSVGPGTRANLDEFTYTTSSA
IEKVGGAKKGKALAIINPAEPPLIMRNTIYCLTESAPDQARITESILQMIGEVQKYVPGY
RLVNGPSYDGNKVSVFMEVAGLGDYLPKYAGNLDIMTAAATRTAEMFAEEILAGKIKLKT
AEVA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatcaaatgcgccctgatcggctcgggcaacatcggcaccgacctgatctac
aagatcaagcgcagcccggtactggagccggtgtggatggtgggcatcgacccggcgtcc
gaggggctggcgcgcgcccgcgaactcggcctgaaaaccaccgccgacggcgtggatggc
ctgctgccgcatgtgctggaagacggcatccagatcgccttcgacgccaccagcgcctat
gtgcacgcggagaactcgcgcaagctcaacgagctgggcgtgatgatgatcgacctgacg
cccgccgccatcggcccgctgtgcgtgccgccggtgaacctgcgccagcatgccgaccgc
gtggagatgaacgtgaacatgatctcctgcgccggccaggcgacgattcccatcgtcaat
gcggtgtcgcgcgtgcagggcgtggaatacgccgagatcgtcgccagcctggcgtcgaag
tcggtggggccgggcacccgcgccaatctggacgaattcacctacaccacctcgtcggcc
atcgaaaaagtcggcggcgcgaagaagggcaaggcgctggccatcatcaacccggccgag
ccgccgctgatcatgcgcaacaccatctactgcctcaccgagtcggcgcccgaccaggcg
cgcatcaccgaatccatcctgcagatgatcggtgaagtgcagaaatacgtgcccggctac
cggctggtgaacgggccgagctacgacggcaacaaggtctcggtgttcatggaggtcgcc
ggcctgggcgactacctgccgaagtacgccggcaatctggacatcatgaccgcggccgcg
acccgcaccgccgagatgttcgccgaggagatcctggccggaaagatcaagctgaagacc
gcggaggtggcgtga

DBGET integrated database retrieval system