KEGG   Azoarcus sp. BH72: azo1856Help
Entry
azo1856           CDS       T00441                                 

Gene name
lapF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
azo  Azoarcus sp. BH72
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    azo1856 (lapF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    azo1856 (lapF)
   00650 Butanoate metabolism
    azo1856 (lapF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    azo1856 (lapF)
   00622 Xylene degradation
    azo1856 (lapF)
   00621 Dioxin degradation
    azo1856 (lapF)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     azo1856 (lapF)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     azo1856 (lapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2038548..2039462
Genome map
AA seq 304 aa AA seqDB search
MKKIKCALIGSGNIGTDLIYKIKRSPVLEPVWMVGIDPASEGLARARELGLKTTADGVDG
LLPHVLEDGIQIAFDATSAYVHAENSRKLNELGVMMIDLTPAAIGPLCVPPVNLRQHADR
VEMNVNMISCAGQATIPIVNAVSRVQGVEYAEIVASLASKSVGPGTRANLDEFTYTTSSA
IEKVGGAKKGKALAIINPAEPPLIMRNTIYCLTESAPDQARITESILQMIGEVQKYVPGY
RLVNGPSYDGNKVSVFMEVAGLGDYLPKYAGNLDIMTAAATRTAEMFAEEILAGKIKLKT
AEVA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatcaaatgcgccctgatcggctcgggcaacatcggcaccgacctgatctac
aagatcaagcgcagcccggtactggagccggtgtggatggtgggcatcgacccggcgtcc
gaggggctggcgcgcgcccgcgaactcggcctgaaaaccaccgccgacggcgtggatggc
ctgctgccgcatgtgctggaagacggcatccagatcgccttcgacgccaccagcgcctat
gtgcacgcggagaactcgcgcaagctcaacgagctgggcgtgatgatgatcgacctgacg
cccgccgccatcggcccgctgtgcgtgccgccggtgaacctgcgccagcatgccgaccgc
gtggagatgaacgtgaacatgatctcctgcgccggccaggcgacgattcccatcgtcaat
gcggtgtcgcgcgtgcagggcgtggaatacgccgagatcgtcgccagcctggcgtcgaag
tcggtggggccgggcacccgcgccaatctggacgaattcacctacaccacctcgtcggcc
atcgaaaaagtcggcggcgcgaagaagggcaaggcgctggccatcatcaacccggccgag
ccgccgctgatcatgcgcaacaccatctactgcctcaccgagtcggcgcccgaccaggcg
cgcatcaccgaatccatcctgcagatgatcggtgaagtgcagaaatacgtgcccggctac
cggctggtgaacgggccgagctacgacggcaacaaggtctcggtgttcatggaggtcgcc
ggcctgggcgactacctgccgaagtacgccggcaatctggacatcatgaccgcggccgcg
acccgcaccgccgagatgttcgccgaggagatcctggccggaaagatcaagctgaagacc
gcggaggtggcgtga

DBGET integrated database retrieval system