KEGG   Azoarcus sp. BH72: azo1919Help
Entry
azo1919           CDS       T00441                                 

Definition
oxidoreductase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    azo1919
   00330 Arginine and proline metabolism
    azo1919
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    azo1919
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    azo1919
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     azo1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2106499..2107608
Genome map
AA seq 369 aa AA seqDB search
METVDCVVVGAGVVGLACARAIAASGREVLILERERAFGTGISSRNSEVIHAGLYYPPGS
LKARLSVAGGRMLYAYCESRGVAHRRCGKLVVAAQREALPALARIRARALANGVEELLWL
EPGAVKEIEPALDSCGALFSPATGIVDSHGLMLALLGDAERHGATLVLDTPVLGGRAEAG
GIVLQTGGEAPMTLQARCVVNAAGLDAVRLAGQLPASSRGLPQAHFARGVYFSYAGRVPF
SHLIYPVPEPGGLGIHLTLDMGGQPRFGPDVEWIDTPDYTVDPARAERFAAAIRKWWPGL
EPERLQPAYAGVRPKIVGPGEADADFQIDGPAEHRVPGLINLLGIESPGLTAALAIGEEV
ARRIAAPQG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggagacagtcgattgcgtggtcgtcggggcgggcgtggtggggctggcctgtgcccgg
gcgattgcggcgagcggccgcgaggtgttgatcctggagcgcgaacgcgcgttcggcacc
ggcatcagctcgcgcaacagcgaggtcatccatgccgggctgtactacccgccgggttcg
ctcaaggcgcgtctcagcgttgccggcggccgcatgctctacgcctattgcgagtcgcgc
ggcgtcgcccaccggcgctgcggcaagctggtggtggcggcgcagcgcgaggcgctgccg
gcgcttgcgcgcatccgggcgcgagcgctcgccaacggcgtggaggaattgctgtggctg
gagccgggcgcggtgaaggagatcgaacccgcgctcgacagctgcggggcgctgttctcg
cccgccaccggcatcgtggacagccatgggctgatgcttgcgctgctcggcgacgctgag
cgccatggcgcgacgctggtgctggacacgccggtgctcggcggtcgggccgaggctggc
ggcatcgtgctgcagacgggcggcgaggcaccgatgaccttgcaggcgcgctgcgtcgtg
aacgcggcggggctcgacgcggtccgccttgccggccaactgccggcgtcgtcacgcggt
ctgccgcaggcgcattttgcccgtggcgtgtatttcagctacgcgggccgggtgccgttc
tcgcacctgatctatccggtgcccgagcccggcggcctgggcatccatctcacgctcgac
atgggcggccagccccgcttcggcccggacgtggagtggatcgacacgcccgattacacg
gtggacccggcgcgggcggagcgtttcgccgcggcgatccgcaaatggtggccgggcctg
gagccggaacggctgcagcccgcgtatgccggcgtgcgacccaagatcgtcggccccggc
gaggcggacgccgatttccagatcgatggccccgccgagcatcgcgtgcctgggctcatc
aacctgctgggcatcgaatcgccggggcttaccgcggcgctcgcaatcggcgaggaagtg
gcgcggcggattgccgcgccgcaaggctga

DBGET integrated database retrieval system