KEGG   Azoarcus sp. BH72: azo1927Help
Entry
azo1927           CDS       T00441                                 

Definition
(GenBank) probable enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00071  Fatty acid degradation
azo00280  Valine, leucine and isoleucine degradation
azo00281  Geraniol degradation
azo00310  Lysine degradation
azo00360  Phenylalanine metabolism
azo00362  Benzoate degradation
azo00380  Tryptophan metabolism
azo00410  beta-Alanine metabolism
azo00627  Aminobenzoate degradation
azo00640  Propanoate metabolism
azo00650  Butanoate metabolism
azo00903  Limonene and pinene degradation
azo00930  Caprolactam degradation
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01212  Fatty acid metabolism
Module
azo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    azo1927
   00650 Butanoate metabolism
    azo1927
  Lipid metabolism
   00071 Fatty acid degradation
    azo1927
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    azo1927
   00310 Lysine degradation
    azo1927
   00360 Phenylalanine metabolism
    azo1927
   00380 Tryptophan metabolism
    azo1927
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    azo1927
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    azo1927
   00281 Geraniol degradation
    azo1927
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    azo1927
   00627 Aminobenzoate degradation
    azo1927
   00930 Caprolactam degradation
    azo1927
Enzymes [BR:azo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     azo1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAL94544
RhizoBase: azo1927
UniProt: A1K6T9
Position
complement(2116100..2116894)
Genome map
AA seq 264 aa AA seqDB search
MTDKAYLPGEGVIVAGPDAGVLEIRLDRPQAKNALSTPLLRSIVALLEQAEHDDAVRCIV
LTGGDQVFAAGADLAEMAAKDMQAVLLEERPRLFGAIARFPKPIIAAVCGYALGGGCELV
MHADIVIAGESAQFGQPEINLGIIPGAGGTQRLTRAVGKSVAMKLVLAGEFIPAQEARAA
GLVAEVVADEACIARAHELAGKIAKKAPLAVRLAKDSVLQAFETPLAAGLAIERRNFVVL
AGTEDRNEGVKSFLEKRKPVWKGR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaaggcttacctgcccggtgagggcgtgatcgtggccggccccgatgccggc
gtactcgaaatccggctggatcgtccgcaggcgaagaacgcattgtcgacgccgctgctg
cgcagcatcgtcgcgctgctggagcaggcggaacacgacgacgcggtgcgctgcatcgtg
ctcaccggcggtgatcaggtgttcgccgccggcgccgacctggccgagatggccgccaag
gacatgcaggcggtgctgctggaagagcggccccggctgttcggcgcgatcgcgcgcttt
cccaagcccatcatcgccgccgtgtgcggctatgcgctgggcggcggttgcgagctggtg
atgcatgccgacatcgtcatcgccggcgagtcggcgcagttcggtcagcccgaaatcaat
ctcggcatcatccccggcgccggcggcacccagcgcctgacccgcgcggtcggcaagtcg
gtggcgatgaagctggtgctggcgggcgagttcatcccggcgcaggaagcgcgcgccgcc
gggctggtggcggaagtggtggccgacgaggcctgcatcgcacgcgcccacgagctggcc
ggcaagatcgccaagaaggcaccgctggcggtgcggctggccaaggattcggtgctgcag
gccttcgagacgccgctcgccgccgggctggcgatcgagcgccgcaacttcgtggtgctc
gccggcaccgaggaccgcaacgagggcgtcaaatccttcctggaaaagcgcaagccggtc
tggaagggccgctga

DBGET integrated database retrieval system