KEGG   Azoarcus sp. BH72: azo1971Help
Entry
azo1971           CDS       T00441                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00010  Glycolysis / Gluconeogenesis
azo00071  Fatty acid degradation
azo00350  Tyrosine metabolism
azo00625  Chloroalkane and chloroalkene degradation
azo00626  Naphthalene degradation
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo1971
  Lipid metabolism
   00071 Fatty acid degradation
    azo1971
  Amino acid metabolism
   00350 Tyrosine metabolism
    azo1971
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    azo1971
   00626 Naphthalene degradation
    azo1971
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     azo1971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CAL94588
RhizoBase: azo1971
UniProt: A1K6Y3
Position
complement(2167420..2168526)
Genome map
AA seq 368 aa AA seqDB search
MKTMKAARLHEIGGSFAIDEVPVPKPGPQDVLVRVEACGLIPNLRNVVTHFPTWYPFLPL
PALPAIFGLDAAGTVAAVGEGVKSVRPGDRVYVNPGLSCGECRYCKQGEPTRCDAYTFMG
YFGFGKGSQALFERYPYAGYAEYMTAPVANLVRLPDQVSSAQAARFGYMGTAYSALRKAA
LQAGQSVLILGATGTLGVGAVLLALGFGAARVVVVGRDRALLDRLLRLDPKRVVPLPLDG
QPIHPRVREQVPGGVDAMLDTLGAKAPAELSVDAMQAVARGGRIVQIGGVAGPIPIDPHP
FMCAQLQYIGSLWFTAAEGDEMLAMIEAGLVDLSVLEPRPYPLEALNEALEDIQTQANGF
TNFHIAHR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatgaaggcggcccgcctgcacgagatcggcggcagctttgcaatcgacgaa
gtcccggtgcctaaacccggcccgcaggacgtgctggtgcgcgtggaggcgtgcggactg
atccccaacctgcgcaacgtcgtcacccatttccccacctggtatcccttcctgccgctg
ccggcgctgccggccatcttcgggctggacgccgcgggcaccgtggctgcggtgggggag
ggggtgaagtcggtgcggccgggcgatcgggtgtacgtcaatcccggcctgtcctgcggc
gaatgccgctactgcaagcagggcgagccgacgcgctgcgacgcctacaccttcatgggc
tacttcggtttcggcaagggttcgcaggcgctgttcgagcgttatccctacgccggctac
gccgaatacatgacggcgccggtcgccaacctggtccgcctgccggatcaggtcagcagc
gcgcaggcggcccgcttcggctacatgggcaccgcctactccgcgctgcgcaaggccgcg
ctgcaagcgggtcagagcgtgctgatcctcggcgcgaccggcaccctgggtgtcggcgcg
gtgctgctggcgctgggattcggcgccgcccgcgtggtcgtcgtggggcgcgaccgcgca
ctgctcgaccgcctgctgcggctcgatccgaagcgggtcgtgccgctgccgctggatgga
caaccgatccatccgcgcgtgcgcgagcaggttccgggcggcgtggacgcgatgctcgac
accctgggcgccaaggcgcccgcggaactctcggtggatgcgatgcaggcggtggcgcgc
ggcggccgcatcgtccagatcggcggcgttgcggggccgatcccgatcgacccgcacccc
ttcatgtgcgcgcagttgcagtacatcggctcgctctggttcaccgctgccgagggcgac
gaaatgctggcgatgatcgaagccggcctggtggacctgagcgtgctggaaccgcgcccc
tatccgctggaagccttgaacgaggcgctggaagacatccagacccaggccaacggcttc
accaacttccacatcgcccaccgctga

DBGET integrated database retrieval system