KEGG   Azoarcus sp. BH72: azo1971Help
Entry
azo1971           CDS       T00441                                 

Definition
putative alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    azo1971
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo1971
  Lipid metabolism
   00071 Fatty acid degradation
    azo1971
  Amino acid metabolism
   00350 Tyrosine metabolism
    azo1971
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    azo1971
   00626 Naphthalene degradation
    azo1971
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     azo1971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2167420..2168526)
Genome map
AA seq 368 aa AA seqDB search
MKTMKAARLHEIGGSFAIDEVPVPKPGPQDVLVRVEACGLIPNLRNVVTHFPTWYPFLPL
PALPAIFGLDAAGTVAAVGEGVKSVRPGDRVYVNPGLSCGECRYCKQGEPTRCDAYTFMG
YFGFGKGSQALFERYPYAGYAEYMTAPVANLVRLPDQVSSAQAARFGYMGTAYSALRKAA
LQAGQSVLILGATGTLGVGAVLLALGFGAARVVVVGRDRALLDRLLRLDPKRVVPLPLDG
QPIHPRVREQVPGGVDAMLDTLGAKAPAELSVDAMQAVARGGRIVQIGGVAGPIPIDPHP
FMCAQLQYIGSLWFTAAEGDEMLAMIEAGLVDLSVLEPRPYPLEALNEALEDIQTQANGF
TNFHIAHR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatgaaggcggcccgcctgcacgagatcggcggcagctttgcaatcgacgaa
gtcccggtgcctaaacccggcccgcaggacgtgctggtgcgcgtggaggcgtgcggactg
atccccaacctgcgcaacgtcgtcacccatttccccacctggtatcccttcctgccgctg
ccggcgctgccggccatcttcgggctggacgccgcgggcaccgtggctgcggtgggggag
ggggtgaagtcggtgcggccgggcgatcgggtgtacgtcaatcccggcctgtcctgcggc
gaatgccgctactgcaagcagggcgagccgacgcgctgcgacgcctacaccttcatgggc
tacttcggtttcggcaagggttcgcaggcgctgttcgagcgttatccctacgccggctac
gccgaatacatgacggcgccggtcgccaacctggtccgcctgccggatcaggtcagcagc
gcgcaggcggcccgcttcggctacatgggcaccgcctactccgcgctgcgcaaggccgcg
ctgcaagcgggtcagagcgtgctgatcctcggcgcgaccggcaccctgggtgtcggcgcg
gtgctgctggcgctgggattcggcgccgcccgcgtggtcgtcgtggggcgcgaccgcgca
ctgctcgaccgcctgctgcggctcgatccgaagcgggtcgtgccgctgccgctggatgga
caaccgatccatccgcgcgtgcgcgagcaggttccgggcggcgtggacgcgatgctcgac
accctgggcgccaaggcgcccgcggaactctcggtggatgcgatgcaggcggtggcgcgc
ggcggccgcatcgtccagatcggcggcgttgcggggccgatcccgatcgacccgcacccc
ttcatgtgcgcgcagttgcagtacatcggctcgctctggttcaccgctgccgagggcgac
gaaatgctggcgatgatcgaagccggcctggtggacctgagcgtgctggaaccgcgcccc
tatccgctggaagccttgaacgaggcgctggaagacatccagacccaggccaacggcttc
accaacttccacatcgcccaccgctga

DBGET integrated database retrieval system