KEGG   Azoarcus sp. BH72: azo1998Help
Entry
azo1998           CDS       T00441                                 

Definition
5'-methylthioadenosine phosphorylase (EC:2.4.2.1)
Orthology
K00772  
5'-methylthioadenosine phosphorylase [EC:2.4.2.28]
Organism
azo  Azoarcus sp. BH72
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    azo1998
Enzymes [BR:azo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.28  S-methyl-5'-thioadenosine phosphorylase
     azo1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2199402..2200142)
Genome map
AA seq 246 aa AA seqDB search
MLAIIGGSGLTQLSTLEVVRREVCRTPYGEPSGALTFGTLAGKPVVFLARHGYGHTIPPH
LVNYRANIWALHQARATAVVSVASVGGIRADFAPGTLAVPDQIIDYTWGRKNTFFDGGEA
PVRHIDFTHPYDEKLRRSLLAAATDAGEPIFDGGVYASMQGPRLETAAEINRLERDGADL
VGMTGMPEAALARELDLPYAALNVVVNYAAGRSSSEHGIHFDSIELVLQEAMLRVRRVLE
ALCRAG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcaatcatcggtggtagcggactgacccagctttctacgctggaagtcgtacgt
cgcgaggtctgtcgcaccccctatggcgagccctccggcgcactcactttcggcacgctt
gccggcaagccggtggtctttctcgcccgccatggctacggccatacgattccgccgcac
ctggtgaactaccgcgccaacatctgggcgctgcatcaggcacgggccaccgcggtggtg
tccgtcgcgtcggtgggcggaatccgcgccgatttcgcgccgggcacgctcgcggtgccg
gaccagatcatcgactacacctggggccgcaagaacaccttcttcgatggcggcgaggcc
cctgtccgtcacatcgacttcacccacccctacgacgaaaaactgcgccgcagcctgctc
gcggcggcaaccgacgcgggcgaaccgatcttcgacggcggcgtgtacgccagcatgcag
gggccgcggctggaaaccgccgccgaaatcaaccgcctggaacgcgacggcgccgacctg
gtgggcatgaccggcatgccggaagccgccctcgcgcgtgagctggatctgccctacgcg
gcgctgaacgtggtggtgaactacgcggcgggacgttcgtccagcgagcacggcatccac
ttcgacagcatcgaactggtgttgcaggaagcgatgctgcgggtgcggcgcgtgctggaa
gccctgtgccgggcaggttga

DBGET integrated database retrieval system