KEGG   Azoarcus sp. BH72: azo1998Help
Entry
azo1998           CDS       T00441                                 

Definition
5'-methylthioadenosine phosphorylase (EC:2.4.2.1)
Orthology
K00772  
5'-methylthioadenosine phosphorylase [EC:2.4.2.28]
Organism
azo  Azoarcus sp. BH72
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:azo00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2199402..2200142)
Genome map
AA seq 246 aa AA seqDB search
MLAIIGGSGLTQLSTLEVVRREVCRTPYGEPSGALTFGTLAGKPVVFLARHGYGHTIPPH
LVNYRANIWALHQARATAVVSVASVGGIRADFAPGTLAVPDQIIDYTWGRKNTFFDGGEA
PVRHIDFTHPYDEKLRRSLLAAATDAGEPIFDGGVYASMQGPRLETAAEINRLERDGADL
VGMTGMPEAALARELDLPYAALNVVVNYAAGRSSSEHGIHFDSIELVLQEAMLRVRRVLE
ALCRAG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcaatcatcggtggtagcggactgacccagctttctacgctggaagtcgtacgt
cgcgaggtctgtcgcaccccctatggcgagccctccggcgcactcactttcggcacgctt
gccggcaagccggtggtctttctcgcccgccatggctacggccatacgattccgccgcac
ctggtgaactaccgcgccaacatctgggcgctgcatcaggcacgggccaccgcggtggtg
tccgtcgcgtcggtgggcggaatccgcgccgatttcgcgccgggcacgctcgcggtgccg
gaccagatcatcgactacacctggggccgcaagaacaccttcttcgatggcggcgaggcc
cctgtccgtcacatcgacttcacccacccctacgacgaaaaactgcgccgcagcctgctc
gcggcggcaaccgacgcgggcgaaccgatcttcgacggcggcgtgtacgccagcatgcag
gggccgcggctggaaaccgccgccgaaatcaaccgcctggaacgcgacggcgccgacctg
gtgggcatgaccggcatgccggaagccgccctcgcgcgtgagctggatctgccctacgcg
gcgctgaacgtggtggtgaactacgcggcgggacgttcgtccagcgagcacggcatccac
ttcgacagcatcgaactggtgttgcaggaagcgatgctgcgggtgcggcgcgtgctggaa
gccctgtgccgggcaggttga

DBGET integrated database retrieval system