KEGG   Azoarcus sp. BH72: azo2080Help
Entry
azo2080           CDS       T00441                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    azo2080 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    azo2080 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    azo2080 (thrC)
Enzymes [BR:azo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     azo2080 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2285402..2286865)
Genome map
AA seq 487 aa AA seqDB search
MKYISTRGHAGQPANPEFCDILLGGLAPDGGLYLPETYPQVTRAELDAWRKLSYADLAFA
ILSKFITDIPAADLKAICDKTYTADVYRHVRAGDNPADITPVHWLEKDAAGKGSFGLLEL
SNGPTLAFKDMAMQLLGNLFEYVLAKRSETINILGATSGDTGSAAEYAMRGKHGVRVFML
SPHGKMSAFQRAQMYSLQDGNIFNIAVTGMFDDAQDIVKAVSNDHAFKAKYKIGAVNSIN
WARVAAQIVYYFKGYFAATESNDQQVAFCVPSGNFGNICAGHIARQMGLPVAKLILATNE
NDVLDEFFRTGVYRPRKAAETHVTSSPSMDISKASNFERFVFDLVGRDPQKVAALWKQVD
GGAAFDLTASGEFSRIGGFGFASGSSSHADRLATIRKVFDKYGVMIDTHTADGVKVAWEK
ADTVPAGVPVLVLETALPVKFAETIQEALGREPERPADLEGIEALPQRVEVMAPDVEAVK
RFITTRV
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtacatctccacccgcggccacgccggccagcccgccaatcccgaattctgcgac
atcctgctcggcggcctggcgcccgacggcggcctctacctgccggaaacctatccgcag
gtgacccgcgccgaactcgacgcctggcgcaagctctcctacgccgacctggccttcgcc
atcctgtcgaagttcatcaccgacattcccgccgccgacctcaaggcgatctgcgacaag
acctacaccgccgatgtctaccgccacgtgcgcgccggcgacaaccccgccgacatcacc
ccggtgcactggctggagaaggatgccgcgggcaagggcagctttggcctgcttgagctt
tccaatggcccgacgctcgccttcaaggacatggcgatgcagttgctcggcaacctgttc
gagtacgtgctggccaagcgcagcgagaccatcaacatcctcggcgccacctcgggcgac
accggctccgccgcggagtacgcgatgcgtggcaagcacggcgtgcgcgtgttcatgctg
tcgccgcacggcaagatgagcgccttccagcgtgcccagatgtactcgctgcaggacggc
aacatcttcaacatcgccgtcaccggcatgttcgacgatgcccaggacatcgtgaaggcg
gtctccaacgaccacgccttcaaggcgaagtacaagatcggcgcggtcaactcgatcaac
tgggcgcgggtcgcggcgcagatcgtctattacttcaagggctatttcgccgccaccgag
agcaatgaccagcaggtcgcgttctgcgtgccctcgggcaacttcggcaacatctgcgcc
ggccatatcgctcgccagatgggtcttccggtcgccaagctgatcctcgccaccaacgaa
aacgacgtgctcgacgagttcttccgcaccggcgtctatcgcccgcgcaaggcggcggaa
acccatgtcacctccagcccgtcgatggatatctccaaggcgtccaacttcgagcgtttc
gtgttcgacctcgtcggccgcgatccgcagaaggtggccgcgctgtggaagcaggtcgac
ggcggtgccgctttcgatctgaccgcgtccggcgagttctcccgcatcggcggcttcggc
ttcgcctccggcagcagttcgcacgccgaccgcctcgcgaccatccgcaaggtgttcgac
aagtacggcgtgatgatcgacacccacaccgcggacggcgtaaaggtggcttgggagaag
gcggacacagtgcccgccggcgtgccggtgctggtgctggaaaccgcgctgccggtgaag
tttgcggaaaccatccaggaagcgctcggccgtgagcccgagcgtcctgcagacctcgaa
ggcatcgaagcgctgccgcagcgcgtggaagtgatggcgccggatgtcgaggccgtgaag
cgcttcatcactacccgggtctga

DBGET integrated database retrieval system