KEGG   Azoarcus sp. BH72: azo2236Help
Entry
azo2236           CDS       T00441                                 

Gene name
eglA
Definition
putative endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
azo  Azoarcus sp. BH72
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:azo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2450726..2451748)
Genome map
AA seq 340 aa AA seqDB search
MNTMLRRFVRTLATVVLAGTAYSAAAQCDLSRQLAGVNLAGAEFNGKKIPARYGYDYIYP
PAQDLAYFQSVGMNTIRLPFRWERLQPLLGAGLDTAELGRMRTVTEAARSLGMCVILDVH
NYGAYAGQSIGSAAVSEAVFIDFWVKLAREFAGQAHVAFGLMNEPNLITIPQWASLAQRT
VDALRSAGANNLLLVSGGRWSGVHEWQKPINGISNAQAFGSFRDPLNNFVFEVHQYANAS
YSGTTVECIPAEQLRQIMTNASAWARSTGARFFLGEFGVAASEPCLAALDAILAEVDNNP
VWAGWTYWAAGRWWGTYPFSIHPAASGVEAPQLTLIRKYL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgatgctacggcgcttcgtgcgcaccctcgccaccgtcgtgctcgcgggcacc
gcctattccgccgccgcccagtgcgacctcagccgtcagctcgccggggtcaatctcgcg
ggcgcggagttcaacggcaagaagattccggcgcgctacggttacgactacatctacccg
ccggcgcaggatctcgcgtacttccagagcgtcggcatgaacaccatccggctgccgttc
cgctgggagcggctgcagccgctgctgggcgccggcctcgacaccgccgagctggggcgc
atgcgcaccgtcaccgaagcggcgcgcagcctgggcatgtgcgtgatcctcgatgttcac
aactatggcgcctatgcggggcagagcatcggcagcgccgcggtcagcgaggcggtgttc
atcgacttctgggtgaagctcgcgcgcgagttcgccggtcaggcgcacgtggccttcggg
ctgatgaacgagccgaacctgatcacgatcccgcaatgggccagtctcgcccagcgtacc
gtcgatgccttgcgcagcgccggggcgaacaacctgctgctggtttcgggcgggcgctgg
agcggcgtccacgagtggcagaagccgatcaacggcatctccaatgcgcaggccttcggc
agcttccgcgatccgctcaacaacttcgtgttcgaagtgcatcagtacgccaacgccagc
tattccggcaccacggtggagtgcattccggccgagcagctgcgccagatcatgaccaat
gccagcgcctgggcgcgcagcaccggggcccgcttcttcctcggcgaattcggcgtggcc
gccagcgagccctgtctcgccgcgctcgacgccatcctcgccgaggtggacaacaacccg
gtgtgggcggggtggacctactgggcggccgggcggtggtggggcacctatccgttcagc
atccatcccgcggcctccggcgtggaggcgccgcagctgacgctgatccgcaagtacctg
taa

DBGET integrated database retrieval system