KEGG   Azoarcus sp. BH72: azo2414Help
Entry
azo2414           CDS       T00441                                 

Gene name
acsB
Definition
(GenBank) probable acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00010  Glycolysis / Gluconeogenesis
azo00620  Pyruvate metabolism
azo00640  Propanoate metabolism
azo00680  Methane metabolism
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo2414 (acsB)
   00620 Pyruvate metabolism
    azo2414 (acsB)
   00640 Propanoate metabolism
    azo2414 (acsB)
  Energy metabolism
   00680 Methane metabolism
    azo2414 (acsB)
Enzymes [BR:azo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     azo2414 (acsB)
Lipid biosynthesis proteins [BR:azo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   azo2414 (acsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAL95031
RhizoBase: azo2414
UniProt: A1K876
Position
complement(2665962..2667926)
Genome map
AA seq 654 aa AA seqDB search
MSNEQQVRIYNPSEEVVKNAAVSGMEAYWALCKEAEQDYEGYWARNARELIDWKKPFTQV
LDESNAPFFKWFADGQLNVSYNCLDRNVEKGLGDKVALIFEADSGEVTRVTYKDLLGRVC
KFANALRASGIKKGDRVVIYLPMSIEGVVAMQACARIGATHSIVFGGFSAQALRDRINDA
GAVALITSDGQFRGGKALPLKPIADEALSLGGCETIKNVFVVKRTGADVAFVAGRDVWYH
DVVASQSDVCEPEWVDAEHPLFLLYTSGSTGKPKGVQHSTGGYLLHAILTMKYTFDIKPS
DVFWCTADIGWVTGHTYITYGPLACGSTEIVFEGVPTYPDAGRFWKMIQDHKVNIFYTAP
TAIRSLIKAADNNPTVHPKNYDLSSLRILGSVGEPINPAAWEWYYENVGGGRCPIVDTFW
QTETGGHMITPLPGATPLVPGSCTLPFPGIQAAVVDETGTEVPNGQGGILVVKRPWPSMI
RTIWGDPERFKKSYYPDDFKGKLYLAGDGAIRDKETGYFTITGRIDDVLNVSGHRMGTME
IESALVAHEKVAEAAVVGRPDDLTGEAIVAFVVLKGARPTGEAAAAVVKELQNWVGHEIG
PIAKPKDIRFGENLPKTRSGKIMRRLLRQLAKGEEITQDTSTLENPAILEQLKG
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgaacaacaggtccgcatttacaacccctcggaagaagtggtgaagaatgct
gccgtatccggcatggaggcctactgggcactgtgcaaggaagcggaacaagactacgag
ggctactgggcgcgcaacgcccgtgagctgatcgactggaagaagcccttcacgcaggtt
ctggacgagagcaacgcgccgttcttcaagtggttcgccgacggccagctgaacgtgtcc
tacaactgcctcgaccgcaacgtcgagaagggcctgggcgacaaggtcgcgctgatcttc
gaagccgacagcggcgaagtcacccgcgtcacctacaaggacctgctgggccgcgtctgc
aagttcgccaatgcgctgcgcgcctccggcatcaagaagggcgaccgcgtcgtcatctac
ctgccgatgtcgatcgaaggcgtcgtcgcgatgcaggcctgcgcccgtatcggcgccacc
cactccatcgtgttcggcggcttctccgcccaggccctgcgcgaccgcatcaacgatgcc
ggcgccgtggcgctgatcacctccgacggccagttccgcggcggcaaggccctgccgctg
aagccgatcgccgacgaggcgctgtcgctgggcggctgcgaaaccatcaagaacgtgttc
gtggtcaagcgcaccggggccgacgtggccttcgtcgccggccgcgacgtctggtaccac
gacgtggtggccagccagtccgacgtttgcgagccggaatgggtcgatgccgagcatccg
ctgttcctgctctacacctcgggctccaccggcaagccgaagggcgtccagcactccacc
ggcggctacctgctgcacgcgatcctgaccatgaagtacacgttcgacatcaagccgagc
gacgtcttctggtgcaccgcggacatcggctgggtcaccggccacacctacatcacctac
ggcccgctcgcgtgcggcagcaccgaaatcgtgttcgaaggcgtgccgacctacccggac
gccggccgcttctggaagatgatccaggaccacaaggtcaacatcttctacaccgcgccg
accgccatccgttcgctgatcaaggccgcggacaacaatccgacggtgcatccgaagaac
tacgacctgtcctcgctgcgcatcctgggttcggtcggtgagccgatcaacccggcggcg
tgggagtggtactacgagaacgtcggcggcggccgctgcccgatcgtcgataccttctgg
cagaccgaaaccggcggccacatgatcaccccgctgccgggcgcaaccccgctggtgccg
ggttcgtgcacgctgcccttcccgggcatccaggctgccgtggtcgatgaaaccggcacc
gaagtgcccaacggccagggcggcatcctggtggtcaagcgtccgtggccgtcgatgatc
cgcaccatctggggcgacccggagcgcttcaagaagtcctactacccggacgacttcaag
ggcaagctctacctcgccggcgacggtgcgatccgcgacaaggaaaccggctacttcacc
atcaccggccgtatcgacgatgtgctgaacgtttccggccaccgcatgggcacgatggaa
atcgaatccgcgctggtcgcccacgagaaggttgccgaagctgcggtcgtcggccgtccg
gatgacctgaccggtgaagccatcgtcgctttcgtggtgctgaagggcgcccgtccgacc
ggcgaagccgctgccgccgtggtcaaggaactgcagaactgggttggccacgaaatcggg
ccgatcgccaagccgaaggacatccgcttcggtgagaacctgcccaagacccgctccggc
aagatcatgcgccgcctgctgcgccaactggccaagggcgaagagatcacccaggacacc
tcgacgctcgagaatccggcgatcctggagcagctgaagggctaa

DBGET integrated database retrieval system