KEGG   Azoarcus sp. BH72: azo2453Help
Entry
azo2453           CDS       T00441                                 

Definition
(GenBank) probable negative transcriptional regulator
  KO
K07734  
transcriptional regulator
Organism
azo  Azoarcus sp. BH72
Brite
Transcription factors [BR:azo03000]
 Prokaryotic Type
  Other transcription factors
   Others
    azo2453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(2707510..2708151)
Genome map
AA seq 213 aa AA seqDB search
MYIPAHFAEPDPEKLHALMRAHPLATVVTTSSAGLSADHLPLHIAMASDGRLLLRGHVAR
ANPLWRNAADGVAALAVFAGPEAYVTPTWYPAKRDHGRAVPTWNYAVVHAHGSLRAIDDP
AWLRSVLAELTAAHEGARPQPWTLDDAPSDYIDAMLRAVVGIEIEVQRLEGKYKASQNQP
AANRAGVIEGLRGEGREQARAMADLVEESAPPR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtatattccagcgcactttgccgagccggacccggagaaactgcacgcgctgatgcgc
gcgcatccgctggccacggtggtgacaacgtcatcggccggcctgagtgccgatcatctt
cccttgcacatcgccatggccagcgacggccgtctgctgctgcggggccatgtggcacgc
gcgaatccgctctggcgcaacgcggccgacggggttgcggcgctcgcggtgtttgccggc
cccgaggcctacgtgacgcccacctggtatcccgccaagcgcgaccacggccgcgcggtg
ccgacctggaactacgccgtggtgcatgcgcacggcagcctgcgtgcaatcgacgacccg
gcgtggctgcgttcggtgctggcggaactgaccgccgcccacgaaggcgcccggccgcag
ccctggacgctggacgatgcaccgtccgactacatcgacgcgatgttgcgcgccgtggtc
gggatcgagattgaagtgcagcggctggaagggaagtacaaggccagccagaaccaacct
gccgccaaccgcgcgggcgtgatcgagggcctgcgcggggaagggcgcgagcaggcgcgg
gcgatggccgacctggtggaggaatcggccccaccgcgctga

DBGET integrated database retrieval system