KEGG   Azoarcus sp. BH72: azo2562Help
Entry
azo2562           CDS       T00441                                 

Gene name
ccp
Definition
putative cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
azo  Azoarcus sp. BH72
Brite
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     azo2562 (ccp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2839343..2840350
Genome map
AA seq 335 aa AA seqDB search
MKRVLTSLSVALAAGLATWGAVHAADSEPIQPIRAPQNINLGMVELGKKLYFDPRLSKSG
FISCNSCHNLSMGGTDNIPTSIGDHWQQGPINAPTVLNASLNLAQFWDGRAADLKEQAGG
PIANPGEMAFTHTLALNVLSSIPGYTREFRQVFGKDKIDIEQVTLAIAEFEKTLVTPNSR
FDLWLLGKKDALTPTELAGYELFKTSGCVACHNGEAVGGNSFQKMGLIEPYKARSKAEGR
SAVTGKDSDRFNFKVPTLRNVELTYPYFHDGAANTLSEAVDVMGRLQLGRKFSPDENAKI
VAFLKTLTGDQPTFTLPILPPSADSTPRPTPFAAH
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgtactgacctcgctttccgtcgcccttgcggcgggcctggccacctggggc
gcggtgcacgccgcggattccgagcccatccagccgatccgcgcgccgcagaacatcaac
ctgggcatggtcgaactgggcaagaagctgtacttcgacccacgcctgtccaagtccggc
ttcatctcctgcaactcctgtcacaacctgtcgatgggcggcaccgacaacattcccacc
tcgatcggcgaccactggcagcagggcccgatcaacgcccccaccgtgctcaacgccagc
ctcaacctcgcgcagttctgggacggccgcgcggccgacctgaaggaacaggccggcggc
cccatcgccaatccgggcgagatggctttcacccacaccctggcgctcaacgtgctgtcg
tccatccccggctatacgcgtgagttccgccaggtgttcggcaaggacaagatcgacatc
gagcaggtgacgctcgcgatcgccgagttcgaaaaaacgctggtgacgcccaactcgcgc
ttcgacctgtggttgctcggcaagaaagacgcgctgacgccgaccgaactcgccggctac
gagttgttcaagaccagcggctgcgtggcctgccacaacggcgaggcggtgggcggcaac
tccttccagaagatgggtctgatcgagccgtacaaggccaggagcaaggccgagggccgc
tcggcggtcaccggcaaggacagcgaccgcttcaacttcaaggtgccgacgctgcgcaac
gtcgaactcacctatccgtacttccacgacggcgccgccaacaccctgagcgaggcggtg
gacgtgatgggccgcctgcagctggggcgcaagttctcgcccgacgagaatgcgaagatc
gtcgccttcctgaagacgctcaccggcgaccagccgaccttcacgctgcccatcctgccg
ccttcggcagattccacgccgcgccccacgccgttcgcggcgcactga

DBGET integrated database retrieval system