KEGG   Azoarcus sp. BH72: azo2691Help
Entry
azo2691           CDS       T00441                                 

Definition
(GenBank) GGDEF family protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
azo  Azoarcus sp. BH72
Brite
Enzymes [BR:azo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     azo2691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
2965210..2967042
Genome map
AA seq 610 aa AA seqDB search
MTRTPPSAFPPSRPGGDGRRPGTTAETGTAPEIAREALRQLAAQRVPPTPDNYRAFYHQI
AGTAPEEVFPTRALKAIAGALPRSTPEAVRLARQFEEAVAAGQWPALKLAIVAICETRGE
AQLAWGLLIRDLVGQLERNQQGFTRARKLESLQHVLAGSSADPAQLHMRLQGLLRSWGQA
AEGEEEALPGGPAEQPAPAPDTSAPVVAPRAAIEVIGELLARVLTRGVAPVVAHEAELSA
EVAVLAAEATSLADEGSALRYRERLDNFAARLAWYGDDQHAVRDALLTLLRLLVDNIREL
VLDDNWLHGQLSVLAEAFTGELDIRMLDEVERRLRDVIDKQSHLKRQLSDAQQRLKTMLA
GFIDRLASFSNTTGEFHDVLDQCATRISAAHDISELSDVVEQMLRETRNTQESARRSGEE
LAELREQVESANQHILRLQRELDETSELVRHDPLTGALNRKGLDEALAREIARARRHGSP
LCLALLDVDNFKQLNDTYGHRAGDDALRHLFSVIREAVRPQDAVGRYGGEEFLIVLPDTD
TEQAAAVVVRLQRELTRRFFLANSQKLLITFSAGIARLHADEDPQLAIDRADKAMYAAKR
AGKNRVLIAA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcactcccccttccgcctttcccccctcccgaccgggaggagacggccgtaga
cccggcaccaccgccgaaaccggtaccgcccccgaaattgcccgcgaagccctgcgacag
ctcgctgcccagcgcgtaccgccgacgccggacaactaccgcgccttctaccatcagatt
gccggcaccgcgcccgaagaggtttttcccacccgcgccctgaaggcgatcgccggcgcg
ctgccccgctccacgcccgaggccgtgcgcttggcgcgccagttcgaagaagcagtcgcc
gccggtcagtggccggcgctcaagcttgccatcgttgccatctgcgagacgcgcggcgag
gcgcaactcgcctggggtttgctgatccgcgacctcgtcggccagctcgaacgcaaccag
cagggcttcacccgcgcgcgcaagctcgaatcgctgcagcacgtcctcgccggttccagc
gcggaccccgcccagctccacatgcgtctgcagggcctgctgcgcagctggggccaggcc
gcggaaggcgaggaagaggccctgccgggcggcccagcggagcagccggcgcctgcgccc
gatacctcggcacccgtcgtcgcaccgcgggcagccatcgaggtcatcggcgaactgctt
gcgcgcgtgctgacgcgtggggtcgcgccggtcgttgcgcatgaagcggaactgagcgct
gaagtcgcggtactcgcggcggaggcaaccagcctggccgacgaaggcagcgcgctgcgc
taccgcgaacgcctcgacaacttcgccgcccgcctcgcctggtacggcgacgaccagcac
gcggtgcgcgacgccctgctgacgctgctgcggctgctggtggacaacatccgtgagctg
gtgctggacgacaactggctgcacggccagctcagcgtgctcgccgaggccttcaccggc
gagctggatatccgcatgctcgacgaagtcgaacgccgcctgcgcgacgtcatcgacaag
caaagccacctcaaacgccagctgtcggacgcgcagcagcggctgaagaccatgctggcc
ggcttcatcgaccggctcgccagcttctccaacaccaccggcgaattccacgacgtgctc
gaccagtgcgccacccgcatcagcgccgcgcacgacatcagcgagctgtcggatgtggtc
gagcagatgctgcgcgaaacgcgcaacacgcaggagtcggcacgccgttccggcgaagaa
ctggccgaactgcgcgaacaggtggagtcggcgaaccagcacatcctgcgcctgcagcgc
gaactcgacgagaccagcgaactcgtgcggcacgacccgctgaccggcgcgctcaaccgc
aagggcctggacgaagcactggcacgcgagatcgcacgcgcgcggcgccacggcagcccg
ctctgcctcgcgctgctcgacgtcgacaacttcaagcagctgaacgacacctacggccat
cgcgccggcgacgacgcgctccggcacctgttcagcgtgatccgcgaagccgtgcgcccg
caggacgcggtcggccgctacggcggcgaggagttcctgatcgtgctgccggacaccgac
accgaacaggcggccgccgtggtcgtccgcctgcagcgcgaactgacgcgccgcttcttc
ctcgccaactcgcagaagctgctgatcaccttcagcgccggcatcgcccgcctgcatgcc
gacgaagacccgcagctcgcgatcgaccgcgccgacaaggccatgtacgcagccaagcgc
gccggcaagaaccgggtgctcatcgcggcctga

DBGET integrated database retrieval system