KEGG   Azoarcus sp. BH72: azo2698Help
Entry
azo2698           CDS       T00441                                 

Gene name
pepM
Definition
putative phosphoenolpyruvate phosphomutase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
azo  Azoarcus sp. BH72
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:azo00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2975648..2976952
Genome map
AA seq 434 aa AA seqDB search
MKTKIVYVGMSADLVHSGHLNIIRHAASLGEVVIGLLTDKAIASYKRIPYMPFEQRMAVV
ENIKGVSRVVPQTTLDYTPNLELLKPDYVVHGDDWREGVQRETRQKVIDTLKQWGGELVE
IPYTAGISSTRLQAAIKEIGTTPDIRRSALRRLLQVKPLIRFLDIHNALSGLIIEHTAVD
TPSGRREFDGMWGSSLTDSTAKGKPDIEAVDVSARVQTLNEVLEVTTKPIIYDGDTGGQP
EHFNFTVRTLERLGISAIVIEDKTGLKRNSLFGNDVPQTQESIENFCNKIRTGKRAQATD
EFMIIARIESLILDKGVDDAIERAQAYLAAGADGIMIHSRKTTPDEIFAFCERYRQLENR
KYLVAVPSTYNTVTEEELQQRGVNIVIYANHLLRSAYPAMVETARCILEHHRSSECDARL
LPINDILALIPGTR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaagatcgtgtatgtcggcatgagcgccgacctcgtccactcaggccacctg
aacatcatccgccacgctgcaagcctgggcgaagtcgtgatcggactgctgaccgacaag
gccattgcgagttacaagcgcattccgtacatgcccttcgagcaaaggatggcggtggtc
gagaatatcaagggcgtctcgcgcgtcgtgccccagaccacgctcgactacacgccgaat
ctcgaattgctcaaacccgactacgtggtgcacggcgatgactggcgcgagggcgtccag
cgcgaaacgcggcagaaagtcatcgacacgctcaagcaatggggcggcgaactggtggag
attccttacaccgccggcatttcatccacccgtctgcaggccgcgatcaaggaaatcggc
accacgcccgacatccggcgcagcgccctgcgccgcctgctgcaggtcaagccgctgatc
cgctttctcgatatccataacgccctctcggggctgatcatcgagcacaccgcggtggat
acgcccagcggacgacgcgagttcgacggcatgtggggcagcagcctgaccgactcgacc
gcaaagggaaaacccgacatcgaggcggtcgacgtttccgcccgggtgcagacgctcaac
gaagtcctggaagtcaccaccaagcccatcatctacgacggcgataccggcggtcagccc
gaacatttcaacttcacggtccgcacgctggagcgcctgggcatctcggcgatcgtcatc
gaggacaagaccgggctgaagcgcaattcgctgttcggcaacgacgtgccgcaaacgcag
gagagcatcgagaacttctgcaacaagatccgcaccggcaagcgcgcgcaggcgaccgac
gagttcatgatcatcgcccgcatcgaaagcctcatcctggacaagggcgtcgatgatgcg
atcgaacgtgcgcaagcctatctggccgcgggcgcggacggcatcatgatccacagccgc
aagaccacgcccgacgaaatcttcgcgttctgcgagcgctaccgccagctcgaaaaccgc
aagtacctggtggcggtgccgtccacctacaacaccgtcaccgaagaagaactgcagcaa
cgcggcgtgaacatcgtcatctacgccaaccacctgttgcgcagcgcgtacccggccatg
gtcgagaccgccaggtgcatcctggagcatcaccgctcctccgagtgcgacgcccggctg
cttccgatcaacgatatattggcactcattccaggcacccgatga

DBGET integrated database retrieval system