KEGG   Azoarcus sp. BH72: azo2700Help
Entry
azo2700           CDS       T00441                                 

Definition
(GenBank) conserved hypothetical alcohol dehydrogenase
Organism
azo  Azoarcus sp. BH72
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
2978078..2979187
Genome map
AA seq 369 aa AA seqDB search
MPLTAWSYHNPVRVVGASLSTLAPQLPHGRRVLLVTSRGAAERGIARQLEAALPGRTVAL
LDDVAPNPDLRYLDETAARLRGTEIDLVIALGGGSVLDAGKVLALLLRRPEPDLLAQCFR
NRRDVAWTARLPLVAIPTTAGAGAEVTPFATVWDHERSAKHSLATPFAYPDLAVLDAALT
LTLPPEHTLYPALDALSHALESLWNRSATPVSRGLALQALALASRALPEVLAQPGDLARR
ADMQHASLLAGMAISQTRTAVAHAISYPLTLHHGVPHGLACSFTLPTLLRTNLDRIAHNP
SERLLLEAVLAMLDTFGLGQRLLQYLQRDDVRRLHGEMFTAERSNNYNGVPFADVAEIID
SALAQTGKD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcttaccgcctggagctaccacaacccggtcagggtcgtcggcgccagcctgtcg
acgctggccccgcagttgccgcacggaaggcgtgtattgctggtgaccagccgcggcgcc
gcggagcggggaatcgcccgtcagctcgaagcggccctgcccggccggacggtcgcgcta
ctggatgatgtcgcccccaaccccgacctccgctacctggacgaaacggctgcccgcctg
cggggtacggaaatcgatctggtgattgcgctcggcggcggcagcgttctcgacgcgggc
aaggtgctcgccctcctcctgcgccgtccggaacccgatctgctcgcgcagtgcttccgc
aacaggcgcgatgtcgcgtggaccgcgcggctgcccttggtcgccattccgaccacggcg
ggcgccggtgccgaagtgacgccgttcgcgacggtgtgggatcacgaacgcagcgccaag
cactcgctcgccacccccttcgcctatccagaccttgcggtgctggacgcagcgctgacg
ctgacgcttccgccggagcacaccttgtacccggcgctggacgccctgtcccacgcactg
gagtcgctgtggaaccgcagcgcgacgccggtcagccgcgggctggcccttcaggccctg
gcgctggccagccgcgcactacccgaggtgcttgcgcagccgggcgatctcgcgcgccgg
gcagacatgcaacacgccagcctccttgccggcatggcgatcagtcagacgaggaccgcg
gtcgcccatgcgatctcctaccccctgaccctccaccacggcgttccccacgggctcgcc
tgcagcttcacgctgcccacgctcctgcgcaccaacctcgaccgcattgcgcacaacccg
tcggaacgtctgctgctggaagcggtgctggcgatgctcgacaccttcggcctgggccag
cgcctgctccagtatctgcagcgcgatgacgtgcggcggctgcatggcgaaatgtttacc
gccgagcgcagcaacaactacaacggggtgccgttcgccgacgtggccgagatcatcgat
tccgcccttgcgcagacgggcaaggactag

DBGET integrated database retrieval system