KEGG   Azoarcus sp. BH72: azo2751Help
Entry
azo2751           CDS       T00441                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:azo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3033471..3034961)
Genome map
AA seq 496 aa AA seqDB search
MSYVLALDQGTTSSRAMVFDAAGRVRSVARRDFTQSFPQPGWVEHDPAEILRSQFDCARD
ALADAGLRAGQLAAIGIANQRETTVLWERASGRALAPAIVWQDRRTAAKCAELRARGVWS
EALRERTGLELDPYFSATKLAWLLDHVPDARRRAEAGELAFGTVDSWLVWHLSGGRLHVT
DHGNAARTLLLDIHRRDWDDALLALFDIPRAVLPRLVDSIGVCGESDPAVLGAAVPIAGI
AGDQQAATFGQHCFAPGMAKNTYGTGCFLLMNTGATPVKSSHRLLSTVGWTQGAAHTYAL
EGSIFMGGATVQWLRDGLGLIREAAEVEALAARVPDSGGVVLVPAFTGLGAPYWDAAARG
ALFGLTRGSGPAHIARAALDAIALQTDDLVRAMTADGAGPLHELRVDGGAAANNLLMQLQ
ADMLGVAVVRPRMLETTALGAACLAGIGAGVWRDTDALAPHWQIDRVFTPAWSEDQRGAV
RARWADAVARSRAWAA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgtgctggccctcgaccaaggcacgacgagttcgcgcgcgatggtcttcgac
gctgccggcagggtacgcagcgtcgcccggcgcgacttcacccagtccttcccgcagccc
ggctgggtggagcacgacccggcggaaatcctgcgcagccagttcgactgcgcgcgcgat
gcgttggcggatgccgggctgcgtgcgggccagctggccgccatcggcatcgccaaccag
cgcgaaaccaccgtgctgtgggagcgcgccagcggtcgcgcgctggcgccggccatcgtg
tggcaggaccggcgcaccgccgccaagtgcgccgaactgcgcgcacgcggggtctggtcc
gaggccctgcgcgagcgcaccgggctggagctggacccgtatttctccgccaccaagctt
gcgtggctgctcgatcatgtgcctgacgcgcggcggcgcgccgaggccggcgagctggcc
ttcggcacggtcgacagctggctggtgtggcacctcagcgggggccggctgcacgtcacc
gaccacggcaacgccgcccgcacgctgctgctcgacatccaccggcgcgactgggacgac
gccttgctcgcgctgttcgacatcccgcgcgcggtcctgccgcgtctggtcgacagcatc
ggcgtctgcggcgagagcgatccggccgtgctcggcgccgcagtgccgattgccggcatc
gccggcgaccagcaggcggcgaccttcggccagcactgctttgcgcccggcatggccaag
aacacctacggcaccggctgcttcctgctgatgaacacgggagcgacgccggtgaagtcc
agccaccgcctgctttccactgttggctggacgcagggcgccgcgcacacctatgcgctg
gagggcagcatcttcatgggcggggcaaccgtgcagtggctgcgggacggacttggcctc
atccgcgaagcggccgaggtggaggcgctggcggcgcgggttcccgacagcggcggcgtg
gtgctggtgccggctttcaccgggctgggggcaccgtactgggatgcggcggcacgcggc
gcgctgttcggccttacccgcggcagcggccccgcccacattgcacgcgccgcgctggac
gcgattgcgctgcagaccgacgacctggtccgcgcgatgacggccgatggcgccggcccc
ttgcacgagctgcgggtcgatggcggcgccgccgccaacaacctgttgatgcagttgcag
gccgacatgctgggcgttgcggtcgtgcggccgcgcatgctcgagaccaccgcgctcggc
gcggcctgtctggccggcatcggtgccggcgtatggcgggacaccgacgcgctcgcgcca
cactggcagatcgaccgcgtcttcacgccggcatggagcgaggaccagcgtggggcagtg
cgcgcacgctgggcagacgcagtcgcgcgttcccgggcctgggctgcatga

DBGET integrated database retrieval system