KEGG   Azoarcus sp. BH72: azo2766Help
Entry
azo2766           CDS       T00441                                 

Definition
(GenBank) soluble lytic murein transglycosylase precursor (EC:3.2.1.-)
Organism
azo  Azoarcus sp. BH72
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
3046921..3047592
Genome map
AA seq 223 aa AA seqDB search
MLRALLLPPRLRRFAVAAVLAAGCSAAWGGAQQYEPLAASVRAALHAAVSDARAPELPIA
DAGERAQWLAEMSRRLQKRIPDADYRTELLTSIHYEATRAGLDPQLVLGLVQVESNFRKY
AISTAGARGFMQVMPFWIQVIGRPDDNLFHLRTNLRYGCTILRHYLDIERGDLYRALGRY
NGSLGKPEYPNLVRTAWERDWSWKPARLTTAAAEPGPLPSLSR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcgccctgctcctgcccccacggctgcgccggtttgccgtggcggccgtactg
gccgcaggctgtagcgccgcatggggcggcgcgcagcagtacgaaccgctcgccgccagc
gtgcgcgccgcgctgcacgccgcggtaagcgatgcccgcgcgcccgaactgccgattgcg
gatgccggcgaacgcgcgcaatggctggcggagatgtcgcgccgcctgcagaagcgtatc
cccgacgcggactaccgcaccgaactgcttaccagcatccactacgaggccacccgggcg
ggcctcgacccgcagttggtgcttggcctcgttcaggtcgagagcaacttccgcaagtac
gccatttccaccgccggcgcacgcggcttcatgcaggtgatgccgttctggatccaggtg
atcggccgtccggacgacaacctctttcatctgcggaccaacctgcgctacggctgcacc
atcctgcgccactatctggacatcgaacggggcgacctctaccgcgcgctggggcgctac
aacggcagtctcggcaagccggagtacccgaacctcgtgcgcaccgcgtgggaacgcgac
tggtcctggaagccggcccgcctcaccaccgccgcggcggagccgggcccgctcccttcg
ctcagccgttga

DBGET integrated database retrieval system