KEGG   Azoarcus sp. BH72: azo2778Help
Entry
azo2778           CDS       T00441                                 

Gene name
pgm
Definition
putative phosphoglucomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo2778 (pgm)
   00030 Pentose phosphate pathway
    azo2778 (pgm)
   00051 Fructose and mannose metabolism
    azo2778 (pgm)
   00052 Galactose metabolism
    azo2778 (pgm)
   00500 Starch and sucrose metabolism
    azo2778 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    azo2778 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    azo2778 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    azo2778 (pgm)
Enzymes [BR:azo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     azo2778 (pgm)
    5.4.2.8  phosphomannomutase
     azo2778 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3057734..3059125
Genome map
AA seq 463 aa AA seqDB search
MTQSKPFVPAPEIFKAYDIRGIVDKTLTVEAVRAIGQALGSEARARGQKAIAVGRDGRLS
GPALAGALADGIRAAGVDVVDIGCVPTPLTYFAAYHLGTDSCVSVTGSHNPPDYNGLKMV
LGGQTLYGEQILDLRRRLIEGDLTEGAGELRTADVNAAYLERVTSDVKLSRPMKIVMDCG
NGVAGAIAPALFKQLGCELVELFCEVDGNFPNHHPDPSKPENLEDVVRALKETDAELGLA
FDGDGDRLGVVTKDGEIIFPDRQLMLFAEDVLSRVPGGEIIYDVKCTRNLAGWIKQRGGK
ATMWNTGHALVKAKLKETGAPLAGEMSGHMFFKERWYGFDDGLYAGARLLEILSRSGDAN
AVLKGLPDAVSTPELNIKMNEGEPFELVKRLKEQAQFDGAVERITLDGVRVEYADGFGLA
RPSNTTPVVVLRFEANDAAALTRIQDAFRTAITSVWPGVKLPF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtccaagccctttgttcccgcccctgaaatcttcaaggcctacgacatccgc
ggcatcgtcgacaagacgctgacggtcgaggcggtgcgcgccatcggccaggccctcggc
tccgaggcccgcgcccgcggccagaaggcgatcgcggtcggccgcgacggccgcctgtcc
ggcccggcactcgccggcgcactggccgacggcatccgcgccgccggcgtggacgtggtc
gacatcggctgcgtacccaccccgctcacctacttcgccgcctaccacctcggcaccgac
tcctgcgtgtcggtcaccggcagccacaacccgccggactacaacggcctcaagatggtg
ctcggcggccagacgctgtacggcgaacagatcctcgacctgcgccgccgcctgatcgag
ggcgacctcaccgagggcgccggggagctgcgcacggcggacgtcaacgcggcctatctg
gaacgcgtcacctccgacgtcaagctctcccgccccatgaagatcgtcatggactgcggc
aacggcgtcgccggcgcaatcgccccggcgctgttcaagcagctcggctgcgaactggtg
gaactcttctgcgaggtcgacggcaacttccccaaccaccatccggatccgtccaagccc
gaaaacctggaagacgtggtgcgcgcgctgaaggaaaccgatgccgaactcgggctggcc
ttcgacggcgacggcgatcgcctgggcgtggtgacgaaggacggcgagatcatcttcccc
gaccgccagctgatgctgttcgccgaggacgtgctctcgcgcgtgcccggcggcgagatc
atctacgacgtcaaatgcacccgtaacctcgcgggctggatcaagcagcgcggcggcaag
gcgaccatgtggaacaccggccacgcactggtcaaggccaagctcaaggaaaccggcgcc
ccgctcgctggcgagatgagcggccacatgttcttcaaggaacgctggtacggtttcgac
gacggcctctacgccggcgcccgcctgctcgagatcctgtcgcgctcgggcgacgccaac
gcggtgctgaagggcctgccggacgcggtgagcacgcccgaactcaacatcaagatgaac
gagggcgaacccttcgaactggtcaagcgcctcaaggaacaggctcagttcgacggcgcg
gtcgagcgcatcacgctcgacggcgtgcgcgtggaatacgccgacggtttcggcctggcg
cggccgtccaacaccacgccggtggtggtgctgcgtttcgaggccaatgacgcggccgcg
ctcacgcgcatccaggacgccttccgtaccgccatcacttcggtgtggccgggggtcaag
ctgcccttctga

DBGET integrated database retrieval system