KEGG   Azoarcus sp. BH72: azo2808Help
Entry
azo2808           CDS       T00441                                 

Gene name
gpmA
Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00010  Glycolysis / Gluconeogenesis
azo00260  Glycine, serine and threonine metabolism
azo00680  Methane metabolism
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01200  Carbon metabolism
azo01230  Biosynthesis of amino acids
Module
azo_M00002  Glycolysis, core module involving three-carbon compounds
azo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo2808 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    azo2808 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    azo2808 (gpmA)
Enzymes [BR:azo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     azo2808 (gpmA)
Membrane trafficking [BR:azo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    azo2808 (gpmA)
Exosome [BR:azo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   azo2808 (gpmA)
  Exosomal proteins of melanoma cells
   azo2808 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAL95424
RhizoBase: azo2808
UniProt: A1K9B9
Position
complement(3091417..3092166)
Genome map
AA seq 249 aa AA seqDB search
MYKIVLLRHGESTWNKENRFTGWTDVDLTELGVGEARAAGQLLKREGYSFDLAFTSVLKR
ANKTLNIVLEELDALWLPVEHSWRLNERHYGALQGLNKAETAAKFGDDQVLVWRRSYDIP
PPALEEGDERLNYDDPRYGSLPRARFPRTECLADTVARVVPYWETVIVPQILSGRRILIA
AHGNSLRALIKYLDGISDGDIVGLNIPTAQPLVYELDVNLKPVKSYYLADEDTIRAAQAA
VAGQGKAKG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagatcgtcctgcttcgccacggtgaatccacctggaacaaggaaaaccgcttc
accggctggaccgacgtcgacctcaccgaactcggggtgggcgaggcccgcgcggcgggc
cagttgctcaagcgcgaaggctacagcttcgatctcgccttcacgtcggtgctcaagcgc
gccaacaagacgctgaacatcgtgctcgaggaactcgacgcgctgtggctgccggtcgag
cattcgtggcgcctgaacgaacgccactacggcgcgctgcagggcctgaacaaggccgag
actgcagccaagttcggcgacgaccaggtgctggtgtggcgccgttcctacgacatcccg
ccgccggcgctggaagaaggcgacgagcgtctgaactatgacgatccgcgctacggttcg
ctgccgcgcgcgcgcttcccgcgcaccgaatgcctggccgacaccgtggctcgcgtggtg
ccgtactgggaaaccgtgatcgtgccgcagatcctctccggccgccggatcctgatcgcg
gcgcacggcaacagcctgcgcgccctcatcaagtacctcgatggcatttccgacggtgac
atcgtcgggctcaatattcccacggcgcagccgctggtctatgagcttgacgtgaacctc
aagccggtcaagagctactacctcgccgacgaggacaccatccgcgcggctcaggccgcc
gtggccgggcagggcaaggcaaagggctga

DBGET integrated database retrieval system