KEGG   Azoarcus sp. BH72: azo2839Help
Entry
azo2839           CDS       T00441                                 

Gene name
pgk
Definition
(GenBank) putative phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00010  Glycolysis / Gluconeogenesis
azo00710  Carbon fixation in photosynthetic organisms
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01200  Carbon metabolism
azo01230  Biosynthesis of amino acids
Module
azo_M00002  Glycolysis, core module involving three-carbon compounds
azo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo2839 (pgk)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    azo2839 (pgk)
Enzymes [BR:azo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     azo2839 (pgk)
Exosome [BR:azo04147]
 Exosomal proteins
  Proteins found in most exosomes
   azo2839 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-ProteinID: CAL95455
RhizoBase: azo2839
UniProt: A1K9F0
Position
3118003..3119187
Genome map
AA seq 394 aa AA seqDB search
MQVKKLTDLDVRGKKVFIRADLNVPQDEAGNITEDTRIRASIPSIQYCLDNGAAVMVTSH
LGRPTEGEVGPDDTLAPVAVRLGQLLHKPVKLIANWVEGGFEVKPGEVVLLENCRCNKGE
KKDNEELAKKMAALCDVYVNDAFGTAHRAEATTHGIARFAPVSCAGILMGAEIDALSKAL
HQPARPLVAIVGGAKVSTKLTILKTLADKVDQLIVGGGIANTFLLAAGKRIGESLAEPEM
VREAQQVMDIMKSRGAEVPLPIDVVVADEVSALARANRISVDEVGPHDRILDFGPKTSAK
LADIIAHAGTIVWNGPVGVFEHAQFAGGTKMMASAIAHSEAFSIAGGGDTLAAIAKFHIA
DDVGYISTGGGAFLEFLEGKKLPAIAALEARYEG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcaagaaactcaccgacctcgacgtccgtggcaagaaggtcttcatccgcgcc
gacctcaacgtgccgcaggacgaagccggcaacatcaccgaagacacccgcatccgcgcc
tccatcccgtccatccagtactgcctggacaacggcgccgcggtgatggtcacctcccac
ctcggccgtccgaccgaaggcgaagtcggccccgacgacaccctggcgccggtcgccgtg
cgcctcggccagctgctgcacaagccggtcaagctgatcgccaactgggtcgagggtggt
tttgaagtcaagccgggcgaagtcgtcctgctggaaaactgccgctgcaacaagggcgag
aagaaggacaacgaagagctggcgaagaagatggcggcgctgtgcgacgtctatgtcaac
gacgccttcggcaccgcccaccgcgccgaggccaccacccacggcatcgcccgcttcgcc
ccggtgtcctgcgccggcatcctgatgggggccgagatcgacgcgctgtcgaaggcgctg
caccagccggcccgcccgctggtggccatcgtcggcggcgccaaggtgtcgaccaagctg
accatcctcaagacgctggccgacaaggtcgaccagctcatcgtcggcggcggcatcgcc
aacaccttcctgctggcagccggcaagcgcatcggcgaatcgctggccgagccggaaatg
gtgcgtgaagcccagcaggtgatggacatcatgaagtcgcgcggcgccgaagtgccgctg
ccgatcgacgtcgtggtggcggacgaggtgtcggccctggcgcgcgccaaccggatttcc
gtggatgaagtcggcccgcacgaccgcatcctcgacttcggccccaagacctcggccaag
ctcgccgacatcatcgcgcacgccggcaccatcgtctggaacggtccggtcggcgtgttc
gagcacgcccagttcgccggtggcaccaagatgatggcctcggccatcgcgcactccgag
gcgttctccatcgccggtggcggcgacaccctggccgcgatcgcgaagttccacatcgct
gacgacgtgggctacatctcgaccggcggcggcgccttcctcgagttcctggaaggcaag
aagctgcccgccatcgccgcgctggaagcgcgctacgagggctga

DBGET integrated database retrieval system