KEGG   Azoarcus sp. BH72: azo2839Help
Entry
azo2839           CDS       T00441                                 

Gene name
pgk
Definition
(GenBank) putative phosphoglycerate kinase (EC:2.7.2.3)
  KO
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    azo2839 (pgk)
   01230 Biosynthesis of amino acids
    azo2839 (pgk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo2839 (pgk)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    azo2839 (pgk)
Enzymes [BR:azo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     azo2839 (pgk)
Exosome [BR:azo04147]
 Exosomal proteins
  Proteins found in most exosomes
   azo2839 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
3118003..3119187
Genome map
AA seq 394 aa AA seqDB search
MQVKKLTDLDVRGKKVFIRADLNVPQDEAGNITEDTRIRASIPSIQYCLDNGAAVMVTSH
LGRPTEGEVGPDDTLAPVAVRLGQLLHKPVKLIANWVEGGFEVKPGEVVLLENCRCNKGE
KKDNEELAKKMAALCDVYVNDAFGTAHRAEATTHGIARFAPVSCAGILMGAEIDALSKAL
HQPARPLVAIVGGAKVSTKLTILKTLADKVDQLIVGGGIANTFLLAAGKRIGESLAEPEM
VREAQQVMDIMKSRGAEVPLPIDVVVADEVSALARANRISVDEVGPHDRILDFGPKTSAK
LADIIAHAGTIVWNGPVGVFEHAQFAGGTKMMASAIAHSEAFSIAGGGDTLAAIAKFHIA
DDVGYISTGGGAFLEFLEGKKLPAIAALEARYEG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcaagaaactcaccgacctcgacgtccgtggcaagaaggtcttcatccgcgcc
gacctcaacgtgccgcaggacgaagccggcaacatcaccgaagacacccgcatccgcgcc
tccatcccgtccatccagtactgcctggacaacggcgccgcggtgatggtcacctcccac
ctcggccgtccgaccgaaggcgaagtcggccccgacgacaccctggcgccggtcgccgtg
cgcctcggccagctgctgcacaagccggtcaagctgatcgccaactgggtcgagggtggt
tttgaagtcaagccgggcgaagtcgtcctgctggaaaactgccgctgcaacaagggcgag
aagaaggacaacgaagagctggcgaagaagatggcggcgctgtgcgacgtctatgtcaac
gacgccttcggcaccgcccaccgcgccgaggccaccacccacggcatcgcccgcttcgcc
ccggtgtcctgcgccggcatcctgatgggggccgagatcgacgcgctgtcgaaggcgctg
caccagccggcccgcccgctggtggccatcgtcggcggcgccaaggtgtcgaccaagctg
accatcctcaagacgctggccgacaaggtcgaccagctcatcgtcggcggcggcatcgcc
aacaccttcctgctggcagccggcaagcgcatcggcgaatcgctggccgagccggaaatg
gtgcgtgaagcccagcaggtgatggacatcatgaagtcgcgcggcgccgaagtgccgctg
ccgatcgacgtcgtggtggcggacgaggtgtcggccctggcgcgcgccaaccggatttcc
gtggatgaagtcggcccgcacgaccgcatcctcgacttcggccccaagacctcggccaag
ctcgccgacatcatcgcgcacgccggcaccatcgtctggaacggtccggtcggcgtgttc
gagcacgcccagttcgccggtggcaccaagatgatggcctcggccatcgcgcactccgag
gcgttctccatcgccggtggcggcgacaccctggccgcgatcgcgaagttccacatcgct
gacgacgtgggctacatctcgaccggcggcggcgccttcctcgagttcctggaaggcaag
aagctgcccgccatcgccgcgctggaagcgcgctacgagggctga

DBGET integrated database retrieval system