KEGG   Azoarcus sp. BH72: azo2852Help
Entry
azo2852           CDS       T00441                                 

Gene name
cddD
Definition
(GenBank) probable aldehyde dehydrogenase (NAD+)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00010  Glycolysis / Gluconeogenesis
azo00053  Ascorbate and aldarate metabolism
azo00071  Fatty acid degradation
azo00280  Valine, leucine and isoleucine degradation
azo00310  Lysine degradation
azo00330  Arginine and proline metabolism
azo00340  Histidine metabolism
azo00380  Tryptophan metabolism
azo00410  beta-Alanine metabolism
azo00561  Glycerolipid metabolism
azo00620  Pyruvate metabolism
azo00625  Chloroalkane and chloroalkene degradation
azo00903  Limonene and pinene degradation
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo2852 (cddD)
   00053 Ascorbate and aldarate metabolism
    azo2852 (cddD)
   00620 Pyruvate metabolism
    azo2852 (cddD)
  Lipid metabolism
   00071 Fatty acid degradation
    azo2852 (cddD)
   00561 Glycerolipid metabolism
    azo2852 (cddD)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    azo2852 (cddD)
   00310 Lysine degradation
    azo2852 (cddD)
   00330 Arginine and proline metabolism
    azo2852 (cddD)
   00340 Histidine metabolism
    azo2852 (cddD)
   00380 Tryptophan metabolism
    azo2852 (cddD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    azo2852 (cddD)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    azo2852 (cddD)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    azo2852 (cddD)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     azo2852 (cddD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAL95468
RhizoBase: azo2852
UniProt: A1K9G3
Position
complement(3134727..3136160)
Genome map
AA seq 477 aa AA seqDB search
MALIRNQLFIGGRWVAPVRTGFIDVMDPSTDTVFARIPEGAAADAEAAVAAAHAAFDAWS
RTPLAERAGCIERIAAGLKARSDELAHVIACEVGMPKKLAARVQVGGPLWHWNNYEALAR
SFEWERRVGNSLVVREPIGVVGAITPWNFPLNQITLKVAPALLAGCTVVLKPSEVAPINA
FILAEIIEAAGVPAGVFNLVTGYGPVVGEVLASDPRVDMVSFTGSTRAGRRVAELAAATV
KKVALELGGKSASVVLDDADLAAAVKGTVSSCLLNSGQTCSAHTRLLVPRARLDEAAQLA
ATAASAMKPGPALAEDSRLGPLVSAAQRERVRDYIRRGVAEGARLACGGAEPPAELEQGY
FVQPTVLVCEDSRATVAQEEIFGPVLVVLPHDGDEDAIRIANDSPYGLAGAVWAGNEERA
LAVARRLRTGQVDINGAAWNPRAPFGGYKQSGLGRENGEYGLDEFLQYKAIQLRQPG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatacgcaatcagcttttcatcggtgggcgctgggtggcgcccgtccgaacg
ggtttcatcgacgtgatggacccgagcaccgacaccgtcttcgcgcgcattcccgaaggc
gccgccgccgacgcagaggcggcggtggcggcggcccatgcggccttcgacgcctggtcg
cgcacgccgctggccgagcgcgccggctgcatcgagcgcattgccgccgggctgaaggcg
cgcagcgacgaactggcacacgtcattgcctgcgaggtgggcatgccgaagaagttggcg
gcgcgcgtgcaggtgggcgggccgctgtggcactggaacaactacgaggcgctggcgcgc
agcttcgagtgggaacgccgcgtcggcaattcgctggtagtgcgcgagccgatcggcgtg
gtcggcgcgatcacgccgtggaacttcccgctcaaccagatcacgctgaaggtggcgccg
gcgctgctggccggctgcacggtggtgctcaagccctcggaagtggcgccgatcaacgcc
ttcatcctcgccgagatcatcgaggcggccggcgtgccggcgggcgtgttcaacctcgtc
accggctacggtcccgtggtgggcgaggtgctggcgtccgatccgcgggtcgacatggtg
tccttcaccggctccacccgcgccggccggcgggtggcggaactggccgcggcgacggtg
aagaaggtggcgctggaactcggtggcaagtcggcctcggtggtgctggatgacgccgat
ctggccgcggcggtgaagggcacggtgtcgagctgcctgctcaattccggccagacctgc
tcggcgcacacccggctactggtgccgcgggcgcgcctggacgaggcggcccaactggcg
gcgacggccgcctcggcaatgaaacccggccccgcgctggccgaggacagccgcctaggg
ccgctggtgtccgccgcgcagcgcgagcgcgtgcgcgactacatccgccgcggcgtggcg
gaaggcgcacggctggcgtgcggtggcgcggagccgccggccgagctggagcagggctat
ttcgtccagcccaccgtgctggtatgcgaggacagccgcgccacggtggcgcaggaagag
atcttcggcccggtgctggtggtgctgccgcacgacggcgacgaggacgcgatccgcatc
gccaacgacagcccctacggcctggcgggcgcggtgtgggcgggcaacgaggagcgcgcg
ctggcagtggcgcggcggctgcgcaccgggcaggtggatatcaacggtgcggcctggaac
ccgcgcgcgcccttcggcggctacaagcagtccggcctggggcgcgagaacggcgagtac
gggctggacgaattcctgcagtacaaggcgatccagttgcgccagccgggttga

DBGET integrated database retrieval system