KEGG   Azoarcus sp. BH72: azo2852Help
Entry
azo2852           CDS       T00441                                 

Gene name
cddD
Definition
aldehyde dehydrogenase (EC:1.2.1.3)
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Propanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    azo2852 (cddD)
   00040 Pentose and glucuronate interconversions
    azo2852 (cddD)
   00053 Ascorbate and aldarate metabolism
    azo2852 (cddD)
   00620 Pyruvate metabolism
    azo2852 (cddD)
   00640 Propanoate metabolism
    azo2852 (cddD)
  Lipid metabolism
   00071 Fatty acid degradation
    azo2852 (cddD)
   00561 Glycerolipid metabolism
    azo2852 (cddD)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    azo2852 (cddD)
   00310 Lysine degradation
    azo2852 (cddD)
   00330 Arginine and proline metabolism
    azo2852 (cddD)
   00340 Histidine metabolism
    azo2852 (cddD)
   00380 Tryptophan metabolism
    azo2852 (cddD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    azo2852 (cddD)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    azo2852 (cddD)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    azo2852 (cddD)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     azo2852 (cddD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3134727..3136160)
Genome map
AA seq 477 aa AA seqDB search
MALIRNQLFIGGRWVAPVRTGFIDVMDPSTDTVFARIPEGAAADAEAAVAAAHAAFDAWS
RTPLAERAGCIERIAAGLKARSDELAHVIACEVGMPKKLAARVQVGGPLWHWNNYEALAR
SFEWERRVGNSLVVREPIGVVGAITPWNFPLNQITLKVAPALLAGCTVVLKPSEVAPINA
FILAEIIEAAGVPAGVFNLVTGYGPVVGEVLASDPRVDMVSFTGSTRAGRRVAELAAATV
KKVALELGGKSASVVLDDADLAAAVKGTVSSCLLNSGQTCSAHTRLLVPRARLDEAAQLA
ATAASAMKPGPALAEDSRLGPLVSAAQRERVRDYIRRGVAEGARLACGGAEPPAELEQGY
FVQPTVLVCEDSRATVAQEEIFGPVLVVLPHDGDEDAIRIANDSPYGLAGAVWAGNEERA
LAVARRLRTGQVDINGAAWNPRAPFGGYKQSGLGRENGEYGLDEFLQYKAIQLRQPG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatacgcaatcagcttttcatcggtgggcgctgggtggcgcccgtccgaacg
ggtttcatcgacgtgatggacccgagcaccgacaccgtcttcgcgcgcattcccgaaggc
gccgccgccgacgcagaggcggcggtggcggcggcccatgcggccttcgacgcctggtcg
cgcacgccgctggccgagcgcgccggctgcatcgagcgcattgccgccgggctgaaggcg
cgcagcgacgaactggcacacgtcattgcctgcgaggtgggcatgccgaagaagttggcg
gcgcgcgtgcaggtgggcgggccgctgtggcactggaacaactacgaggcgctggcgcgc
agcttcgagtgggaacgccgcgtcggcaattcgctggtagtgcgcgagccgatcggcgtg
gtcggcgcgatcacgccgtggaacttcccgctcaaccagatcacgctgaaggtggcgccg
gcgctgctggccggctgcacggtggtgctcaagccctcggaagtggcgccgatcaacgcc
ttcatcctcgccgagatcatcgaggcggccggcgtgccggcgggcgtgttcaacctcgtc
accggctacggtcccgtggtgggcgaggtgctggcgtccgatccgcgggtcgacatggtg
tccttcaccggctccacccgcgccggccggcgggtggcggaactggccgcggcgacggtg
aagaaggtggcgctggaactcggtggcaagtcggcctcggtggtgctggatgacgccgat
ctggccgcggcggtgaagggcacggtgtcgagctgcctgctcaattccggccagacctgc
tcggcgcacacccggctactggtgccgcgggcgcgcctggacgaggcggcccaactggcg
gcgacggccgcctcggcaatgaaacccggccccgcgctggccgaggacagccgcctaggg
ccgctggtgtccgccgcgcagcgcgagcgcgtgcgcgactacatccgccgcggcgtggcg
gaaggcgcacggctggcgtgcggtggcgcggagccgccggccgagctggagcagggctat
ttcgtccagcccaccgtgctggtatgcgaggacagccgcgccacggtggcgcaggaagag
atcttcggcccggtgctggtggtgctgccgcacgacggcgacgaggacgcgatccgcatc
gccaacgacagcccctacggcctggcgggcgcggtgtgggcgggcaacgaggagcgcgcg
ctggcagtggcgcggcggctgcgcaccgggcaggtggatatcaacggtgcggcctggaac
ccgcgcgcgcccttcggcggctacaagcagtccggcctggggcgcgagaacggcgagtac
gggctggacgaattcctgcagtacaaggcgatccagttgcgccagccgggttga

DBGET integrated database retrieval system