KEGG   Azoarcus sp. BH72: azo2905Help
Entry
azo2905           CDS       T00441                                 

Gene name
holC
Definition
DNA-directed DNA polymerase (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
azo  Azoarcus sp. BH72
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    azo2905 (holC)
   00240 Pyrimidine metabolism
    azo2905 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    azo2905 (holC)
   03430 Mismatch repair
    azo2905 (holC)
   03440 Homologous recombination
    azo2905 (holC)
Enzymes [BR:azo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     azo2905 (holC)
DNA replication proteins [BR:azo03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     azo2905 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3187931..3188368
Genome map
AA seq 145 aa AA seqDB search
MTKVQFYHNAPDQLALACELVAKAQAGGRQVAVRAADPAMARKLDLMLWTVEPLAFVPHV
MNGGPLADETPVQIGAPGSDARWPHADILFNLAADLAPGFEGFRTVVEIVGRSEAEKAPA
RARWTQYKTRGLPLKAFDAERRVAL
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaggtccagttctatcacaacgcccccgaccagctcgcgctcgcctgcgagctg
gtcgccaaggcgcaggcaggcggacgccaggtcgcggttcgcgctgcggacccggcgatg
gcgcgcaagctggacctgatgctgtggacggtcgaaccgctcgccttcgtaccgcacgtg
atgaacggcggcccgctcgccgatgaaaccccggtgcagatcggcgcccctggcagcgac
gcgcgctggccgcatgccgacatcctgttcaaccttgcggccgacctcgcacccggcttc
gaaggttttcgcaccgtggtcgagatcgtcggccgcagcgaagcagagaaagcgcccgcg
cgtgcgcgctggacccaatacaagacgcgcggcctcccgctcaaggccttcgatgcggaa
cggcgggtggcgctgtga

DBGET integrated database retrieval system