KEGG   Azoarcus sp. BH72: azo3043Help
Entry
azo3043           CDS       T00441                                 

Gene name
paaG4
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
azo  Azoarcus sp. BH72
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    azo3043 (paaG4)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    azo3043 (paaG4)
   00650 Butanoate metabolism
    azo3043 (paaG4)
  Lipid metabolism
   00071 Fatty acid degradation
    azo3043 (paaG4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    azo3043 (paaG4)
   00310 Lysine degradation
    azo3043 (paaG4)
   00360 Phenylalanine metabolism
    azo3043 (paaG4)
   00380 Tryptophan metabolism
    azo3043 (paaG4)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    azo3043 (paaG4)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    azo3043 (paaG4)
   00281 Geraniol degradation
    azo3043 (paaG4)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    azo3043 (paaG4)
   00627 Aminobenzoate degradation
    azo3043 (paaG4)
   00930 Caprolactam degradation
    azo3043 (paaG4)
Enzymes [BR:azo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     azo3043 (paaG4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3347056..3347859)
Genome map
AA seq 267 aa AA seqDB search
MDYSRYTSLEIVRHERGVVELVMGRDGKLPAADHAGHGELADIWRDIDRDPDISVVIVRG
QAKGFSAGGTLELVGDMVESFEHRARVWKEARDIVYNMINCSKIIVSAINGPAVGGGLAV
ALMADISIAAKNARLIDGHTRLGVAAGDHAAMIWPLLCGMAKAKLHLLLSNEISGEEAER
IGLVSMAVEADALMDSALEIANRLAAGPQSALRWTKHSLNNWLRQAGPIFDNSVALEMLG
FTGPEVREGLAAVRERRPAVFPPNAPF
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggactacagccgctacaccagcctcgaaatcgtccgccacgaacgcggcgtcgtcgaa
ctcgtcatgggccgcgatggcaaattgccggcggccgaccacgccgggcacggcgaactc
gccgacatctggcgcgacatcgaccgcgaccccgacatctcggtggtgatcgtgcgcggc
caggccaagggcttttccgccggcggcacgctggaactggtcggcgacatggtggagagc
ttcgagcaccgcgcccgcgtctggaaggaggcgcgcgacatcgtgtacaacatgatcaac
tgctccaagatcatcgtctccgcgatcaacggtcccgcagtcggcggtggcctcgcggtg
gcgctgatggcggacatctccatcgccgccaagaacgcccgcctgatcgacggccacacc
cgcctcggcgtcgccgccggggaccacgccgcgatgatctggccgctcttgtgcggcatg
gccaaggccaagctgcacctgctgctctccaacgaaatctccggcgaggaagccgagcgc
atcggcctggtgtcgatggcggtggaggccgacgcgctgatggacagcgcgctggagatc
gccaacaggctcgccgccggcccgcagagcgcgctgcgctggaccaagcacagcctcaac
aactggctgcgccaggcggggccgatcttcgacaactcggtggcgctggaaatgctcggc
ttcaccggccccgaagtgcgcgagggcctcgccgcggtgcgcgagcgccggccggcggtg
ttcccgcccaacgcgccgttctga

DBGET integrated database retrieval system