KEGG   Azoarcus sp. BH72: azo3113Help
Entry
azo3113           CDS       T00441                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
azo  Azoarcus sp. BH72
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    azo3113 (nosZ)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     azo3113 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3420337..3422271)
Genome map
AA seq 644 aa AA seqDB search
MSREQDLAPEAQPDPSRRRFLNTAAVAGLAGASMSVGLSACNQGNKAATVAAPAAAAVEE
GHSPHLKPGELDTYYGFWSGGHTGDFRVLGLPSGRELHRVPCFVPDALVGWGITNESKAV
MGTKPDGSLKYTVGDTHHTHASYKDGNYDGRYAWINDKINSRIARIRLDYFVCDKITELP
NVQGFHGIFPDKRDPVDPAINYTTRVFCGAEFHIPLPNDGRDMDTPEKYRTLFSCVDAES
MEVRWQVLIDGNCDLVATSYDGKLAATNQYNTEGGFHYEGMMSAERDACLFFNIARIEAA
VKAGKFTTYGNSKVPVVDGTRAANADPKTALTAYVSVPKNPHGVNASPDGKYFICAGKLS
PTGTVIELAKVLDWFDGTLPELDKAIVAEVELGLGPLHTAFDGRGNAYTTLFLDSQIVKW
NVEAAIKFHAGDKTANYVVDRLDVTYQPGHINASQSETMFADGKWLAVGCKFSKDRFLPV
GPLHAETEQLVDISGEKMKLVADHPVRPEPHDFIIFKRELLRPKQIYDMAEFPLAVKDQK
EAGVFRDGKKVTVKIASLAPAFDPREFKVKLGDEVTIILTNLDKVEDLTHGFAIPKYNVN
FIVNPQETKSVTFKADKLGVYWCYCTHFCHALHLEMRARMIVEA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgagccgagaacaagacctggcgccggaagcccagccggatccgagccgtcgcaggttc
ctgaataccgcggcggttgccgggctggccggcgcctcgatgagcgtcggcctgtccgcc
tgcaaccagggcaacaaggctgctacggtcgccgcgcccgccgccgctgcggtggaagag
gggcacagcccgcacctcaagccgggcgaactcgacacctactacgggttctggagcggc
ggccacaccggcgacttccgcgtcctcggcctgccgtccgggcgcgagctgcaccgcgtg
ccctgcttcgtgccggacgcgctggtgggctggggcatcaccaacgaatcgaaagccgtc
atgggcaccaagcccgacggcagcctgaagtacacggtgggcgacacccaccacacccat
gcctcctacaaggacggcaactacgacggccgctatgcctggatcaacgacaagatcaac
agccgcatcgctcgcatccggctcgactacttcgtctgcgacaagatcaccgaactgccc
aacgtgcagggcttccacggcatcttcccggacaagcgcgatccggtggacccggcgatc
aactacaccacgcgcgtgttctgcggcgccgaattccatatcccgctgcccaatgacggc
cgcgacatggatacgccggagaagtaccgcacgctgttctcctgcgtcgatgcggagagc
atggaggtgcgctggcaggtgctgatcgatggcaactgcgacctcgtcgccacctcgtac
gacggcaagctggcggccaccaaccagtacaacaccgaaggcggcttccattacgaaggc
atgatgtcggccgagcgcgacgcctgcctgttcttcaacatcgcccgcatcgaggcggcg
gtgaaggcgggcaagttcaccacctacggcaactccaaggtgccggtggtggatggcacc
cgtgccgccaatgccgatcccaagactgcgctcaccgcctacgtgtcggtgcccaagaat
ccgcacggggtgaatgccagcccggacggcaagtacttcatctgcgccggcaagctgtcg
cccaccggcaccgtcatcgaactcgccaaggtgctcgactggttcgacggcacgcttccc
gaactcgacaaggccatcgtcgcggaagtcgaactcggcctcggcccgctgcacaccgcc
ttcgacggccgcggcaacgcctacaccacgctcttcctcgacagccagatcgtgaagtgg
aacgtggaggcggcgatcaagttccatgctggcgacaagaccgccaactacgtggtcgac
cggctcgacgtcacctaccagccgggccacatcaacgcctcgcagtccgaaaccatgttt
gcggacggcaagtggctggcggtgggttgcaagttctccaaggaccgcttcctgccggtt
ggcccgctgcacgccgagaccgagcaactggtcgacatctccggcgagaagatgaagctg
gtggccgatcacccggtgcgccccgagccgcacgacttcatcatcttcaagcgcgaattg
ctgcgcccgaagcagatctacgacatggcggagttcccgctcgcggtgaaggatcagaag
gaagcgggggtgttccgcgacggcaagaaggtcacggtcaagatcgcctcgctggcgccg
gccttcgacccgcgcgagttcaaggtcaagctcggcgacgaggtcaccatcatcctcacc
aacctcgacaaggtcgaggacctgacgcacggcttcgcgatcccgaagtacaacgtcaat
ttcatcgtcaatccgcaggaaaccaagtccgtcaccttcaaggccgacaagctcggggtg
tactggtgctactgcacccacttctgccacgcgctgcacctcgagatgcgcgcgcggatg
atcgtggaagcctga

DBGET integrated database retrieval system