KEGG   Azoarcus sp. BH72: azo3141Help
Entry
azo3141           CDS       T00441                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
azo  Azoarcus sp. BH72
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:azo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3450110..3450607
Genome map
AA seq 165 aa AA seqDB search
MTAPTRAYVAFGANLGDPAAAFALALERIAALPGTRIAARSALYRTAPVGVGVDLSSQPD
YINAVIALDTTLAPHALLDALLAIEHEGGRTRDYHQAPRTMDLDLLLHGDTVLDDAGLVL
PHPRMHQRAFVLQPLAEIAPTAVVPRHGAVADLLAGVSGQAIQRL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccccgacgcgcgcctacgtggcgttcggggccaacctcggcgatccggctgca
gcctttgccctggcactagaacgcatcgccgccctgcccggcacccgcatcgccgcccgc
tcggcgctctatcgcaccgcgccggtcggtgtgggtgttgatctgagcagccagcccgac
tacatcaatgcggtgatcgcgctcgacaccacgctcgcaccgcatgcgctgctcgatgcg
ctgctggcgatcgagcacgagggcggccgcacccgcgactaccaccaggcgccgcgcacc
atggacctcgacctgctgctgcacggcgacacggtgctggacgacgccggcctggtgctg
ccccacccgcgcatgcaccagcgcgccttcgtgctgcagccgctcgccgagatcgcaccg
accgcggtcgtgccgcgccacggcgccgttgccgacctcctcgccggagtttccggccaa
gccatccaacgcctctga

DBGET integrated database retrieval system