KEGG   Azoarcus sp. BH72: azo3170Help
Entry
azo3170           CDS       T00441                                 

Gene name
proB
Definition
(GenBank) prob protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00330  Arginine and proline metabolism
azo00332  Carbapenem biosynthesis
azo01100  Metabolic pathways
azo01130  Biosynthesis of antibiotics
azo01230  Biosynthesis of amino acids
Module
azo_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    azo3170 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    azo3170 (proB)
Enzymes [BR:azo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     azo3170 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA SAM_2
Motif
Other DBs
NCBI-ProteinID: CAL95787
RhizoBase: azo3170
UniProt: A1KAD1
Position
3478164..3479279
Genome map
AA seq 371 aa AA seqDB search
MRDKIKNARRLIVKVGSALVTNNGAGLDPAALDDWARQIAALRARGREIVLVSSGAIAAG
MQRLGWVKRPHEMHRLQAAAAVGQMGLVEAYEKAFSRHGLQTAQILLTHEDLADRTRYLN
ARSTLVTLLELGVVPIINENDTVVTDEIKFGDNDTLGALVANLVEADTLIILTDQRGLYT
ADPRRDPGATLISEGRAEDRQYEAMAGGAGSGISKGGMITKIRAAQRAARSGAHTCIASG
RETDPLLRLADGEAVGTLLYADSTPLQARKQWLADHLQLAGSLIVDAGAARALDDGRSLL
PVGVVEVQGEFKRGAAVACRDEHGTELARGLVNYSSAECRRILRRPTSDIEQLLGYIDEP
ELIHRDNLVIR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagagacaagatcaagaatgcgcgccggcttatcgtgaaagtcggcagcgccctcgtg
accaacaacggcgcggggctggatcctgccgcactcgacgactgggcgcgacagatcgcc
gcgctgcgtgcgcggggccgcgagatcgtgctggtgtcctcgggcgcgatcgccgccggc
atgcagcgcctggggtgggtcaagcggccgcacgagatgcaccggctgcaggccgccgcc
gccgtgggtcagatggggcttgtggaggcttatgaaaaggcgttctcgcgccacggcctg
cagactgctcagatcctgctcacccacgaggacctcgccgaccgcacgcgctatctgaat
gcgcgctccacgctcgtcacgctgctggaactgggcgtcgtcccgatcatcaacgagaac
gacacggtcgtcaccgacgagatcaagttcggcgacaacgacaccctcggcgccctggtc
gcgaatctggtggaagccgacacgctgatcatcctcaccgaccagcgcggcctgtacacc
gccgacccgaggcgtgacccgggtgcgacgctgatcagcgagggacgcgctgaggacagg
cagtacgaagccatggcgggcggcgctggcagcggcatcagcaagggcggcatgatcacc
aagatccgcgcggcgcagcgtgccgcccgcagcggcgcgcacacctgcattgccagcggg
cgggaaaccgacccgctgctgcgtctggccgacggtgaagcggtgggcacgctgctctat
gccgacagcacgccgctgcaggcccgcaagcagtggctggccgaccacctgcaactcgcg
ggcagcctgatcgtcgatgccggcgccgcgcgcgccctggatgacggccgcagcctgctg
ccggtcggcgtcgtcgaggtgcagggcgagttcaaacgcggggccgcggtcgcctgtcgc
gacgaacacggcaccgaactcgcgcgcggcctggtcaattacagcagcgcggaatgccgt
cgcatcctgcgccgcccgaccagcgacatcgagcaactgctcggctacatcgacgagccc
gaactcatccatcgcgacaacctggtcatccgctag

DBGET integrated database retrieval system