KEGG   Azoarcus sp. BH72: azo3170Help
Entry
azo3170           CDS       T00441                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
azo  Azoarcus sp. BH72
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    azo3170 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    azo3170 (proB)
Enzymes [BR:azo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     azo3170 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3478164..3479279
Genome map
AA seq 371 aa AA seqDB search
MRDKIKNARRLIVKVGSALVTNNGAGLDPAALDDWARQIAALRARGREIVLVSSGAIAAG
MQRLGWVKRPHEMHRLQAAAAVGQMGLVEAYEKAFSRHGLQTAQILLTHEDLADRTRYLN
ARSTLVTLLELGVVPIINENDTVVTDEIKFGDNDTLGALVANLVEADTLIILTDQRGLYT
ADPRRDPGATLISEGRAEDRQYEAMAGGAGSGISKGGMITKIRAAQRAARSGAHTCIASG
RETDPLLRLADGEAVGTLLYADSTPLQARKQWLADHLQLAGSLIVDAGAARALDDGRSLL
PVGVVEVQGEFKRGAAVACRDEHGTELARGLVNYSSAECRRILRRPTSDIEQLLGYIDEP
ELIHRDNLVIR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagagacaagatcaagaatgcgcgccggcttatcgtgaaagtcggcagcgccctcgtg
accaacaacggcgcggggctggatcctgccgcactcgacgactgggcgcgacagatcgcc
gcgctgcgtgcgcggggccgcgagatcgtgctggtgtcctcgggcgcgatcgccgccggc
atgcagcgcctggggtgggtcaagcggccgcacgagatgcaccggctgcaggccgccgcc
gccgtgggtcagatggggcttgtggaggcttatgaaaaggcgttctcgcgccacggcctg
cagactgctcagatcctgctcacccacgaggacctcgccgaccgcacgcgctatctgaat
gcgcgctccacgctcgtcacgctgctggaactgggcgtcgtcccgatcatcaacgagaac
gacacggtcgtcaccgacgagatcaagttcggcgacaacgacaccctcggcgccctggtc
gcgaatctggtggaagccgacacgctgatcatcctcaccgaccagcgcggcctgtacacc
gccgacccgaggcgtgacccgggtgcgacgctgatcagcgagggacgcgctgaggacagg
cagtacgaagccatggcgggcggcgctggcagcggcatcagcaagggcggcatgatcacc
aagatccgcgcggcgcagcgtgccgcccgcagcggcgcgcacacctgcattgccagcggg
cgggaaaccgacccgctgctgcgtctggccgacggtgaagcggtgggcacgctgctctat
gccgacagcacgccgctgcaggcccgcaagcagtggctggccgaccacctgcaactcgcg
ggcagcctgatcgtcgatgccggcgccgcgcgcgccctggatgacggccgcagcctgctg
ccggtcggcgtcgtcgaggtgcagggcgagttcaaacgcggggccgcggtcgcctgtcgc
gacgaacacggcaccgaactcgcgcgcggcctggtcaattacagcagcgcggaatgccgt
cgcatcctgcgccgcccgaccagcgacatcgagcaactgctcggctacatcgacgagccc
gaactcatccatcgcgacaacctggtcatccgctag

DBGET integrated database retrieval system