KEGG   Azoarcus sp. BH72: azo3181Help
Entry
azo3181           CDS       T00441                                 

Definition
dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
azo  Azoarcus sp. BH72
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:azo01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:azo00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:azo00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:azo00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:azo00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:azo00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3492225..3493199)
Genome map
AA seq 324 aa AA seqDB search
MIDQDENKKVGGSLTTLSTDALDAGEVLIRVHYSSINYKDALAATGAGKIIRRFPCVGGI
DLAGEVVESGAAGFLPGDKVIATSFDIGVAHHGGYAEYARVPAQWVLRLPPGLSLFESMA
LGTAGFTAALAIVRMEDNGLAPANGPVIVTGATGGVGGLAIDMLASLGYHVVALTGKEAE
AGYLKMLGASEIKLRSSIDFDAARPLEAAQWAGAVDNVGGQVLHWVLATMKQAGTVASIG
NAASFNISTTVFPFILRGVSLLGVDSGYMGFPMRQRVWDRLATDLKPRHLAAVTRTIAFD
DLPGAFEAFIRGQVKGRTVVRIGA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaccaggacgaaaacaagaaggtgggcggcagcctgacgactctgagcaccgat
gcgctggacgccggggaggtgctgatccgcgttcattactccagcatcaactacaaggat
gcgctggccgcgacgggcgcgggcaagatcatccgccggtttccctgcgtgggcggcatc
gaccttgccggcgaggtggtggagagcggcgctgccggctttcttcccggcgacaaggtc
atcgccaccagtttcgacatcggcgtcgctcatcatggcggctatgccgagtacgcccgg
gtgcccgcgcagtgggtgttgcgcttgccgcccgggctgagcctgttcgagtcgatggcg
ctgggcaccgcggggttcaccgccgcgctcgcgatcgtgcggatggaagacaacggcctg
gcgcccgccaatggtccggtcatcgtcaccggggcaaccggcggcgtgggcgggttggcg
atcgacatgctggccagcctcggttaccacgttgtcgcgctgaccggaaaggaagcggaa
gccgggtatctgaagatgcttggggcgagcgagatcaagctgcgcagcagcatcgacttc
gacgccgcccggccgctggaggccgcgcagtgggccggcgcggtcgacaacgtcggcggg
caggtgttgcactgggtgctggcgaccatgaagcaggccggcaccgtcgccagcatcggc
aacgccgccagcttcaacatcagcaccacggtgttcccgttcatcctgcgcggcgtcagc
ctgctcggggtcgattccggctacatgggctttccgatgcggcagcgggtctgggaccgg
ctcgccaccgacctcaagccccgccatctcgcggccgttacccggactatcgcgttcgat
gacctgccgggcgcgttcgaggccttcatccgggggcaggtcaagggccggacggtcgtc
cggatcggcgcctga

DBGET integrated database retrieval system