KEGG   Azoarcus sp. BH72: azo3247Help
Entry
azo3247           CDS       T00441                                 

Gene name
asn
Definition
(GenBank) probable asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00250  Alanine, aspartate and glutamate metabolism
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    azo3247 (asn)
Enzymes [BR:azo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     azo3247 (asn)
Peptidases [BR:azo01002]
 Cysteine Peptidases
  Family C44
   azo3247 (asn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6
Motif
Other DBs
NCBI-ProteinID: CAL95863
RhizoBase: azo3247
UniProt: A1KAK7
Position
3578572..3580368
Genome map
AA seq 598 aa AA seqDB search
MLEQFSGILRRSPNPDPSAASGTALERVDLGRATVAYRPAIAVARDGTGLCIALGRPRFA
DPALQAIAAQQGPAVAWLQALRDQGESVIPSVRGRFNVVFIERDGAEALFATDRFGTWPL
CYAEQDGALHFADRADALPGPGRRLSAQAVYEYLFFHMIPAPTTIFEGVARLPGGHVLQW
KDGRATCRAWWQPRFDERERPSFESAKRQFLDIVENAVRRDAEGPVGCFLSGGTDSSTVT
GMLCKVLGRPARSYSIGFDASGYDEMEYARIAARHFGADHHEYYVTPDDLLDGIPRVAVH
YDQPFGNSSAVPAWICASRAQDEGVARLLAGDGGDELFGGNTRYAKQRVFGWYDSVPGLV
RRGMLEPVLALPGMGRIPLMKKGVSYVEQARVPMPDRMHMYNMLLRLGTREVFEADFLAR
IDVDRPQQQQREVWQASSARSQVNRMLAYDWKYTLADNDLPKVIGTTQLAGVDVAFPLLS
DELLDFSLTLPPDWKLRGLTLRWFFKEALRGFLPDQIITKKKHGFGLPFGVWACAHAGLK
AQAHDALRSLAARGIVRPRFIDELFTTHLPAHPGYYGEMVWILMMLEFWLRAHDGSTL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgagcagttcagcggcatccttcgccgcagcccaaaccctgacccgagcgccgca
tccggcacggcgctggaacgcgtcgacctcggcagggccacggtggcataccgccccgcc
atcgccgtcgcccgcgacggcaccggactgtgcatcgcgctcggccggccgcgctttgcc
gacccagcgctccaggcgattgccgcacagcaggggccggccgtggcctggcttcaggcc
ctgcgcgaccagggcgaatcggtgattccttccgtgcgcggccgcttcaacgtcgtcttc
atcgaacgcgacggcgccgaggcgctgtttgccaccgaccgtttcggcacctggcccctg
tgctatgcggaacaggacggcgcgctccatttcgccgaccgcgccgacgccttgcccggc
cccgggcgccggctgtcggcacaggccgtgtacgagtacctgttcttccacatgatcccg
gcccccacgacgatcttcgagggcgtcgcgcgactgcccggcgggcatgtgctgcagtgg
aaagacggccgcgcaacgtgccgggcgtggtggcaaccacgtttcgacgaacgcgaacgg
cccagcttcgaatccgcgaaacggcagttcctggacatcgtcgagaacgccgtgcggcgc
gacgcggaaggcccggtcggctgcttcctgtcgggcggcaccgacagctccaccgtcacc
ggcatgctgtgcaaggtcctcggccggcccgcgcgcagctactccatcgggttcgacgca
agcggctacgacgagatggagtacgctcgtatcgccgcccgtcatttcggcgccgaccac
cacgagtactacgttaccccggacgatctgctggacgggattccccgcgtcgcggtccat
tacgaccagcccttcggcaactcctccgcggtgccggcctggatctgcgcgtcccgcgcg
caagacgaaggcgtggcacgactgctggcgggcgacgggggcgacgagttgttcggcggc
aatacccgctacgccaagcagcgtgttttcgggtggtacgacagcgttcccgggctggtg
cggcgcggcatgctcgagccggtgctcgcccttcccgggatgggccgcatcccgctgatg
aagaagggggtgagctacgtcgaacaggcccgtgtgccgatgccggatcgcatgcacatg
tacaacatgctgctgcgactcggcacccgtgaggttttcgaagccgactttctggcccgg
attgacgtcgatcgcccgcagcagcagcagcgcgaggtctggcaggcaagctcggcgcgc
agccaggtcaatcgcatgctggcgtacgactggaaatacaccctggcggacaacgacctg
ccgaaggtcatcggcaccacacaactcgccggcgtcgatgtggcctttcccctgctcagc
gacgaattgctcgacttttcgctcacactgccgcccgactggaagctgcgcggactgacc
ctgcgctggtttttcaaggaggccttgcgcggtttcctgccggaccagatcatcacgaag
aagaagcacgggttcggcctgccgttcggcgtctgggcatgcgcccacgccggactgaag
gcccaggcgcacgacgcgctgcgtagccttgccgcgcgcggcatcgtccgcccccgtttc
atcgacgaactcttcaccactcacctgccagcgcaccccggttactacggcgaaatggta
tggatcctgatgatgctggagttctggctgcgcgcccacgacggcagcaccctctga

DBGET integrated database retrieval system