KEGG   Azoarcus sp. BH72: azo3271Help
Entry
azo3271           CDS       T00441                                 

Gene name
asnB1
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
azo  Azoarcus sp. BH72
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:azo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3606175..3608103)
Genome map
AA seq 642 aa AA seqDB search
MCGIHGFYRFDGRAVERAHLSAMGDVTRHRGPDDEGQHIEPGGRCGIAMRRLSIIDLAGG
HQPISNADDTLWVVCNGEIYNFRELRQELQARGYRFKTGSDSEVLLHLYDLHGDDFVHRL
DGMFNFALWDARRQRLLIGRDHLGVKPLYVHQSASLLAFATEAKALLALPGMQPALNREV
LGDYLHLGYVPAPHSMFAGIRKLPPATLLSVDAQGVREWRYWRLPQTVDRTVGEAEWVER
IRAGMEAAVQRQMVADVPIGAFLSGGVDSSAVVAYMARHSDQPIRTYAIGFEGGEAEQLY
NELPYARQVAGLFGTEHREIVVRPDVVGLLPRLLWHMDEPVADSAFITTYLVSEFARRDV
KVILSGVGGDELFGGYRRYLGGHYLDKLARLPLWSRRLMARTAGLLPSDRHSKVLNTLRL
ARGLLASSELAPDDRYRHYLQVLPRDDVAALTRGQPGGSDALAAAFAAAGNDDALNRMFA
VDAETQLPDDLLLLTDKMSMAVSLECRVPLLDRALVELAASIPESLKVRNGRLKHLMKSA
LADVLPPDILDRRKRGFGTPMGAWLKQQLAPVLRRLLAADVVRDRGLFDPAVVARLVADH
EAARIDGTDALLALMNLEIWSRVHLDRHSVDDVTAELKSLIA
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatccacggtttctatcgcttcgatggccgcgcggtcgagcgcgcgcacctg
tccgcaatgggggatgtcacccgacaccgcgggcccgatgacgaaggccagcacatcgag
ccgggcggacgctgcggcatcgcgatgcgtcgcctgtccatcatcgacctggccggcggc
catcagccgatctccaatgccgacgacaccttgtgggtggtctgcaacggcgagatctac
aatttccgcgagttgcgccaggagctgcaggcgcgcggttaccgcttcaagacggggtcc
gacagcgaggtcctgctgcacctctacgacctgcacggagacgatttcgtccatcgactg
gacggcatgttcaatttcgcgctgtgggacgcccgtcgccagcgcctgctgatcggccgc
gaccacctcggcgtgaagccgctgtacgtgcaccagtccgcgagcctgcttgccttcgcc
accgaggccaaggcgctgctggcgctgcccggcatgcagcccgcgctcaaccgcgaggtg
ctgggcgactacctccatctcggctacgtgcccgcgccgcattcgatgttcgccgggatc
cgcaagctgccgccggccacgctgctgtcggtggatgcccagggcgtgcgcgagtggcgc
tactggcgtctgccgcaaaccgtggaccgcacggtgggcgaggccgaatgggtcgagcgc
atccgcgccggcatggaggctgcggtgcaacggcagatggtggcggacgtcccgatcggc
gccttcctctccggcggagtcgattccagcgcggtggtcgcctacatggcgcgccattcc
gaccagccgattcgcacctatgccatcggctttgaaggcggcgaggccgagcagctgtac
aacgaactgccctacgcgcgccaggtggcggggctgttcggcaccgagcatcgcgagatc
gtcgtccgtccggatgtcgtcggcctgctgccgcggctgctgtggcacatggacgagccg
gtggccgactccgctttcatcaccacttacctggtgtccgagttcgcccgtcgcgacgtc
aaggtcatcctgtcgggggtcggcggggacgaactgttcggcgggtatcgccgttatctc
ggcggccactacctcgacaagctcgcccgcctgccactgtggtcgcgccgactgatggca
cggaccgccgggctgctgccgagcgatcgccactccaaggtgctcaacaccctgcggctc
gcgcgcggcctcctggcttcttccgaactggcgcccgacgaccgctaccgccactacctg
caggtgctgccgcgcgacgacgtggctgcgctgacgcgcgggcagccgggtggcagcgat
gcgcttgccgctgcctttgccgcggctggcaacgacgatgcgctcaaccgcatgttcgcg
gtggacgccgaaacccagttgccggacgacctgctgctgcttaccgacaagatgagcatg
gcggtgtcgctcgaatgccgcgtgccgctgctcgaccgcgccctggtcgaactcgccgcg
tccattccggaaagcctcaaggtccgcaacggacgcctcaagcacctgatgaagtcggcg
ctcgccgacgtgttgccgcccgacatcctcgaccgccgcaagcgcggtttcggtacgccg
atgggcgcgtggctgaagcagcaactggcgccggtgctgcgccgcctgctcgccgccgat
gtcgtgcgcgaccgcggcctgttcgaccccgcggtcgtcgcccgcctggtggccgaccac
gaggccgcgcggatcgacggtaccgatgccttgctcgcgctgatgaatcttgaaatctgg
agccgcgtgcatctcgaccgccacagcgtcgacgatgtcaccgcggagttgaagagcctg
atcgcatga

DBGET integrated database retrieval system