KEGG   Azoarcus sp. BH72: azo3317Help
Entry
azo3317           CDS       T00441                                 

Gene name
yhdH
Definition
(RefSeq) zinc-binding alcohol dehydrogenase (EC:1.1.1.1)
  KO
K19745  
acrylyl-CoA reductase (NADPH) [EC:1.3.1.-]
Organism
azo  Azoarcus sp. BH72
Pathway
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    azo3317 (yhdH)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     azo3317 (yhdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3653743..3654726)
Genome map
AA seq 327 aa AA seqDB search
MFKAILIDKDDTGYRATLQDVHEAQLPAGEVRVRVAWSTLNYKDGLAMTGKVPVVRSFPM
VPGIDFAGTVEESSHPDYKPGDAVVLNGWGVGEVHWGGLAQQARVKADWLIPLPAAFTPR
QAMAIGTAGYTAMLCVLALERHGVTPAAGDVLVTGAAGGVGSVAVALLARLGYRVVASTG
RPSEADYLTHLGAAEIIDRAQFSAPGKPLAKERWAAAIDTVGSHTLANVCASMRYRGVVA
ACGLAQGMDLPATVAPFILRGVTLAGVDSVYCPRPERLQAWQRLATDLDPALLDTITHEI
GLGEAITTAGLLLEGKVRGRVIVDVNR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaggccatcctgatcgacaaggacgacaccggctaccgcgccacgctgcaggac
gtccatgaggctcaactgcccgccggcgaggtgcgcgtgcgggtcgcgtggtccacgctc
aactacaaggacgggctggcgatgaccggcaaggtgccggtggtgcgcagctttccgatg
gtgccgggcatcgatttcgcgggcacggtcgaggagagcagccatcccgactacaagccc
ggtgatgcggtggtgctcaacggctggggcgtgggcgaggtgcattggggcgggctggca
cagcaggcgcgggtgaaggccgactggctgattccgctgccggcggcgtttaccccgcgc
caggcgatggcgatcggcaccgccggctataccgcgatgctgtgcgtactcgcgctggaa
cgccacggggtcaccccggccgccggcgacgtgctggtgaccggcgccgcgggcggggtg
ggcagcgttgcggtggcgctgctggcgcggctgggctatcgcgtcgtcgcctccaccggg
cgcccctcggaggccgactacctgacccacctcggggctgcggagatcatcgaccgcgcc
cagttctccgcgccgggcaaaccgctggcgaaggagcgctgggccgcggcgatcgacacc
gtcggcagccatacactcgccaacgtctgcgccagcatgcgctaccgcggcgtcgtcgcc
gcctgcgggttggcgcagggcatggatctgcccgccacggtggcgcccttcatcctgcgc
ggcgtcacgctggcaggggtggatagcgtgtattgcccgcggccggaacgcctgcaggcc
tggcagcggcttgcgaccgacctcgatccggcgctgctcgacaccatcacccacgagatc
ggcctgggcgaggcgatcaccaccgccgggctgctgctcgaaggcaaggtgcgcggccgc
gtcatcgtcgacgtcaatcgctga

DBGET integrated database retrieval system