KEGG   Azoarcus sp. BH72: azo3333Help
Entry
azo3333           CDS       T00441                                 

Gene name
sucC
Definition
(GenBank) probable succinyl-CoA synthetase, beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
azo  Azoarcus sp. BH72
Pathway
azo00020  Citrate cycle (TCA cycle)
azo00640  Propanoate metabolism
azo00660  C5-Branched dibasic acid metabolism
azo01100  Metabolic pathways
azo01110  Biosynthesis of secondary metabolites
azo01120  Microbial metabolism in diverse environments
azo01130  Biosynthesis of antibiotics
azo01200  Carbon metabolism
Module
azo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    azo3333 (sucC)
   00640 Propanoate metabolism
    azo3333 (sucC)
   00660 C5-Branched dibasic acid metabolism
    azo3333 (sucC)
Enzymes [BR:azo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     azo3333 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: CAL95949
RhizoBase: azo3333
UniProt: A1KAU3
Position
complement(3673743..3674903)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQAKEVLRKYGVVTPRGIPCFSVDEAVKAAEELGGKIWVVKAQIHAGGRGKGGGV
KLGKSLDEVRTLAGQILGMQLVTHQTGPEGQKVRRLLIEEGADIKKEYYVAALTDRATQK
VAMMASSEGGMDIEEVAHNTPEKIIKVFVDPLAGLTDAQAIELAKGIGVPEASIPQAVDT
FKKLYTCYMETDASLAEINPLILEGNGNIKALDAKFNFDSNALFRHPEIVAYRDLDEEDA
DEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGAEPANFLDVGGGATTEKVTE
AFKIMLKNPKVKGILVNIFGGIMKCDTIATGVVAAAKEVNLSVPLVVRMKGTNEDLGKKI
LAESGLPIISADTMAEAATKIVAEVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcatgagtatcaggcaaaagaagtactgagaaagtacggcgtcgtcacgccg
cgcggcattccgtgtttttccgtcgatgaggcggtgaaggcggctgaagaactcggcggc
aagatctgggtggtgaaggcccagatccatgctggcggtcgcggcaagggcggtggcgtc
aagctcggcaagtcgctggacgaagttcgcaccctggctggccagatcctgggcatgcag
ctggtcacccatcagaccggcccggaaggccagaaggttcgccgcctcctgatcgaggaa
ggcgccgacatcaagaaggaatactacgttgccgcgctgaccgaccgcgctacccagaag
gttgccatgatggcctcctccgaaggtggcatggacatcgaggaagtcgcgcacaacacc
cccgagaagatcatcaaggtcttcgtcgatccgctcgccggcctgaccgacgcgcaggcc
atcgaactggccaagggtatcggcgttcctgaagcttcgatcccgcaagcggtcgacacc
ttcaagaagctctacacctgctacatggaaaccgatgcctcgctggcggaaatcaacccg
ctgatcctcgaaggcaacggcaacatcaaggcgctcgacgccaagttcaacttcgactcc
aacgcgctcttccgtcacccggaaatcgttgcctaccgcgacctggatgaagaagacgcc
gacgaaatcgaagcctccaagttcgacctcgcctacatcagcctcgacggcaacatcggc
tgcctggtgaacggcgccggtctggcgatggccaccatggacaccatcaagctgttcggt
gccgagccggccaacttcctcgacgtgggcggcggcgccaccaccgagaaggtcaccgaa
gccttcaagatcatgctcaagaaccccaaagtcaagggcatcctggtcaacatcttcggc
ggcatcatgaagtgcgacaccatcgccaccggcgtggtcgctgcagccaaggaagtgaat
ctctccgtcccgctcgtggtgcgcatgaagggcaccaacgaagacctcggcaagaagatc
ctcgccgagtcgggcctgcccatcatctccgccgacaccatggcggaagccgcgaccaag
atcgtggctgaggtcaagtaa

DBGET integrated database retrieval system