KEGG   Azoarcus sp. BH72: azo3790Help
Entry
azo3790           CDS       T00441                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
azo  Azoarcus sp. BH72
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:azo00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:azo00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4151089..4151679
Genome map
AA seq 196 aa AA seqDB search
MRTTALALTLLALATAAVVYAASEAPVPAATQAAAPASPLLDHSFRRLHGAETLNLRERY
AGQPLLIVNTASHCGYTGQFKELEAIHQRYRAQGLKVLGFSSDDFNQEADNEAKAANVCF
VNFGVTFDMFAPIHVRGGDAHPLFRELARQSQAPRWNFHKYVVDRQGKVVASFESAVKPD
APEVLAALERAIAGAR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactaccgcccttgccctgaccttgctcgccctcgccaccgcggccgttgtgtac
gccgccagcgaggcgcccgtaccggccgcgacgcaagccgccgcacctgccagcccgctg
ctcgaccacagcttccgccgcctgcacggggccgaaacgctcaacctgcgcgaacgctat
gccggccaaccgctactcatcgtcaacaccgccagccattgcggctacaccggccagttc
aaggaactggaagccatccaccagcgctaccgcgcgcaggggctgaaggtgctcggcttc
tcgtcggacgacttcaaccaggaggccgacaacgaagccaaggccgccaacgtctgcttc
gtgaacttcggcgtcaccttcgacatgttcgcgcccatccacgtgcgcggcggcgacgcg
cacccgctgttccgcgaactcgcgcgccagtcgcaggcgccgcgctggaatttccacaag
tacgtggtcgaccgccagggcaaggtggtggccagcttcgagagcgcggtcaagccggac
gcccccgaagtgctcgccgcgctcgaacgcgcgattgcgggcgctcgctga

DBGET integrated database retrieval system