KEGG   Azoarcus sp. BH72: azo3790Help
Entry
azo3790           CDS       T00441                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
azo  Azoarcus sp. BH72
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    azo3790
  Metabolism of other amino acids
   00480 Glutathione metabolism
    azo3790
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     azo3790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4151089..4151679
Genome map
AA seq 196 aa AA seqDB search
MRTTALALTLLALATAAVVYAASEAPVPAATQAAAPASPLLDHSFRRLHGAETLNLRERY
AGQPLLIVNTASHCGYTGQFKELEAIHQRYRAQGLKVLGFSSDDFNQEADNEAKAANVCF
VNFGVTFDMFAPIHVRGGDAHPLFRELARQSQAPRWNFHKYVVDRQGKVVASFESAVKPD
APEVLAALERAIAGAR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactaccgcccttgccctgaccttgctcgccctcgccaccgcggccgttgtgtac
gccgccagcgaggcgcccgtaccggccgcgacgcaagccgccgcacctgccagcccgctg
ctcgaccacagcttccgccgcctgcacggggccgaaacgctcaacctgcgcgaacgctat
gccggccaaccgctactcatcgtcaacaccgccagccattgcggctacaccggccagttc
aaggaactggaagccatccaccagcgctaccgcgcgcaggggctgaaggtgctcggcttc
tcgtcggacgacttcaaccaggaggccgacaacgaagccaaggccgccaacgtctgcttc
gtgaacttcggcgtcaccttcgacatgttcgcgcccatccacgtgcgcggcggcgacgcg
cacccgctgttccgcgaactcgcgcgccagtcgcaggcgccgcgctggaatttccacaag
tacgtggtcgaccgccagggcaaggtggtggccagcttcgagagcgcggtcaagccggac
gcccccgaagtgctcgccgcgctcgaacgcgcgattgcgggcgctcgctga

DBGET integrated database retrieval system