KEGG   Azoarcus sp. BH72: azo3855Help
Entry
azo3855           CDS       T00441                                 

Definition
putative alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
azo  Azoarcus sp. BH72
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    azo3855
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    azo3855
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    azo3855
Enzymes [BR:azo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     azo3855
Exosome [BR:azo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   azo3855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4224451..4226037
Genome map
AA seq 528 aa AA seqDB search
MQPKALAISIALALCAAQAHAAGNAVPTSAEEWFAAGRAAVETSKHVVPNRARAKNVILF
VGDGMGVSTVTAARILEGQMRNADGEFNRLSFEKLDHMGTSVTASANQQTSDSAPTATAM
VTGIKTNDGAISVDQTIERNEPSATVTRAKSVKTILEQAEERGMSTGIVTTARLTHATPA
VNYAHIGNRDWEADSNLPAGATVADIARQLLEFPYGDGLEVALGGGRSYFMPNTASDPEY
PSQKGRRKDGRDLTKEWTTKYKQSAYVWDKAAFDAVNPQQTKHLLGLFERSHMRYEADRK
DDVAGEPSLAEMTEKAIKMLGQNKKGFYLMVEAGRIDHAHHAGNAYRALTDTVALSEAVE
VAKRLTDDQDTLIVVTADHSHVFTIAGYPSRGNPILGKSAIDGVASTDALGLTYTTVSYA
NGPGWTGGFQRKEYNPATEGSVAAPYNGSALRPNLAGIDTTAPNYMQEATVPMGSETHAG
EDVAIYASGPNAYLFRGPQEQNVIYHVMADALGLNKGGHGHGHGRGRD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccaaggccctcgccatcagcatcgccctcgccctgtgcgccgcacaggcgcac
gccgcaggcaacgcggttcccaccagcgccgaagaatggttcgccgccggccgcgccgcg
gtggaaacctccaagcacgtggtgcccaaccgcgcccgcgccaagaacgtcatcctcttc
gtcggcgacggcatgggcgtctccaccgtcaccgccgcgcgcatcctggaaggccagatg
cgcaacgccgacggcgagttcaaccgcctcagcttcgaaaagctggaccacatgggcacc
tcggtgaccgcgtccgccaaccagcagacctccgactccgccccgaccgccaccgcgatg
gtcaccggcatcaagaccaacgacggcgcgatctcggtggaccagaccatcgagcgcaac
gagccgagcgccactgtgacccgcgccaagagcgtcaagaccatcctcgagcaggccgag
gaacgcggcatgtccaccggcatcgtgaccaccgcccgcctcacccatgccacgccggcg
gtgaactacgcccacatcggcaaccgcgactgggaagccgacagcaacctgccggccggc
gccaccgtggccgacatcgcccgccagctgctcgaattcccctatggcgacggcctggaa
gtggcgctcggcggcggccgcagctacttcatgccgaacaccgcgagcgacccggaatac
cccagccagaagggccgccgcaaggacggccgcgacctgaccaaggaatggacgacgaag
tacaagcaatccgcctacgtctgggacaaggccgcgttcgacgcggtgaacccgcagcag
accaagcacctgctcggcctcttcgagcgttcgcacatgcgttatgaggccgaccgcaag
gacgacgtcgccggcgaaccctcgctcgccgagatgaccgagaaggcgatcaagatgctg
ggccagaacaagaagggcttctacctgatggtggaagccggccgcatcgaccacgcccac
cacgccggcaacgcctaccgcgcgctgaccgacacggtggcgctgtccgaagcggtggaa
gtggccaagcgcctgaccgacgaccaggacaccctgatcgtcgtcaccgccgaccacagc
cacgtgttcaccatcgccggctacccgtcgcgcggcaacccgatcctgggcaagagcgcg
atcgacggcgtcgcctccaccgacgcgctcggcctgacctacaccaccgtgtcctacgcc
aacggcccgggctggaccggcggcttccagcgcaaggaatacaacccggccaccgaaggc
agcgtcgcggcgccgtacaacggcagcgcgctgcgtcccaacctggccggtatcgacacc
accgcgcccaactacatgcaggaagcgaccgtgccgatgggctccgagacccacgccggc
gaggacgtggcgatctacgccagcggccccaacgcctacctgttccgtggcccgcaggaa
cagaacgtgatctatcacgtgatggccgatgcgctgggcctcaacaagggcgggcatggg
cacgggcacggtcgcggccgcgattga

DBGET integrated database retrieval system