KEGG   Azoarcus sp. BH72: azo3885Help
Entry
azo3885           CDS       T00441                                 

Definition
(GenBank) putative phosphoprotein phosphatase
  KO
K20074  
PPM family protein phosphatase [EC:3.1.3.16]
Organism
azo  Azoarcus sp. BH72
Brite
Enzymes [BR:azo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     azo3885
Protein phosphatases and associated proteins [BR:azo01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    azo3885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
4259097..4259867
Genome map
AA seq 256 aa AA seqDB search
MLDLQTAYISRIGRRKRNEDACGYWTSPQGCCWIVSDGAGGHGSGDRAAQIVVSTVLERF
SAHPEVSEAHAIGLLEAAQAAVMAEKHANPGGDDMHATAALLLIDAGRREAVWSHVGDTR
IYLFRNRELIHQTRDHSLVQSMIDAGYGDAAMIRTHPQRSLLTSAIGNADDLALSVSGAP
VAIAPGDAFLICSDGWWEYVDEARMAAELGAGGSATDWLERMAAVVEAHDNHHSDNYTAV
AVKAYRAEDEITVLLP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacctccagaccgcctacatctcccgcatcggccgccgcaagcgcaacgaggac
gcctgcggctactggacctcgccgcagggctgctgctggatcgtctccgacggcgccggc
ggccacggcagcggcgaccgcgccgcgcagatcgtcgtcagcaccgtgctggaacgcttt
tccgcccatcccgaagtgagcgaagcccacgcgatcggcctgctcgaagcggcacaggcc
gcggtgatggccgagaagcacgccaacccgggcggcgacgacatgcacgccaccgcggcg
ctgctgctgatcgacgccgggcgccgcgaggcggtgtggtcgcacgtcggcgacacccgc
atctacctgttccgcaaccgcgagctgatccaccagacgcgcgaccacagcctggtgcaa
agcatgatcgacgccggttacggcgacgccgcgatgatccgcacccacccccagcgcagc
ctgctgacctcggcgatcggcaacgccgacgacctcgcgctcagcgtatcgggcgcgccg
gtggcgatcgcgccgggcgacgccttcctgatctgcagcgacggctggtgggagtacgtc
gatgaagcacgcatggcggccgaactcggcgccggcggttcggccaccgactggctggag
cgcatggcggcggtggtcgaagcccatgacaaccaccacagcgataactacactgccgtc
gcggtcaaggcctaccgcgccgaagacgagatcacggtgttgctgccctga

DBGET integrated database retrieval system