KEGG   Azoarcus sp. BH72: azo3976Help
Entry
azo3976           CDS       T00441                                 

Definition
uracil-DNA glycosylase (EC:3.2.2.-)
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
azo  Azoarcus sp. BH72
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:azo00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    azo3976
Enzymes [BR:azo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     azo3976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4356228..4356950
Genome map
AA seq 240 aa AA seqDB search
MTAASLVNAARTLSEQVDSLHFAPPVSHVYNPLGYAWDIHRAYLERYGEGRKRVIFLGMN
PGPFGMAQIGVPFGEIATARDWLGLAGAVGQPAQVNPKRPVEGFDCARSEVSGQRLWGLF
RSRFNTPAAFFADHFVVNYCPLAFFDHGRNLTPDKLPAGEQRPLLAACDAHLRAVTQALE
PEWVIGVGAWAEKRAAEALAGLPVKLGRILHPSPASPAANRGWAEAATRQLEQLGIWSAA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagcctccctcgtcaacgccgcccgcacgctctctgaacaggtcgacagcctg
catttcgcccccccggtcagccacgtctacaacccgctcggctacgcctgggacatccac
cgggcgtacctggaacggtatggcgaaggacgcaagcgggtgatcttcctcggcatgaac
cccgggcccttcggcatggcgcagatcggtgtgcccttcggcgaaatcgccactgcgcgc
gactggctggggctggccggcgcggtgggacaacccgcgcaggtcaatcccaagcgcccg
gtggaaggtttcgactgcgcccgctcggaagtgagcggccagcgcctgtggggcttgttc
cgcagccgcttcaacaccccggccgccttcttcgccgaccatttcgtcgtcaactactgt
ccgctcgcgttcttcgaccacggccgcaacctgacccccgacaagcttcccgccggcgag
cagcgccccttgctggccgcgtgcgacgcgcacctgcgcgcggtaacacaggcgctggag
ccggaatgggtgatcggggtcggcgcctgggcggaaaagcgggctgccgaggcgctggcc
ggcctccccgtcaagctcggacgcatcctgcatcccagccccgccagccccgccgcgaac
cgtggctgggcggaggcggcgacgcgccagctcgagcagctcgggatctggagtgcggca
tga

DBGET integrated database retrieval system