KEGG   Brucella abortus A13334: BAA13334_I00011Help
Entry
BAA13334_I00011   CDS       T01704                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
baa  Brucella abortus A13334
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:baa00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:baa00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:7258..8598
Genome map
AA seq 446 aa AA seqDB search
MAQIDCRTNASAQKVNSMDRIKIVGGNKLNGVIPISGAKNAALPLMIASLLTDDTLTLEN
VPHLADVEQLIRILSNHGVDYSVNGRREHQNGPYSRTIHFTARNIVDTTAPYELVSRMRA
SFWVIGPLLARMGEANVSLPGGCAIGTRPVDLLLDALLALGAEIDIENGYAKAKARNGLV
GARYKFPKVSVGATHVMLMAATLAKGETIIENAAREPEVANLADCLNAMGAKISGAGSST
IHVQGVTNLSGARVRIIPDRIEAGTYAMAVAMTGGDVLLEGAQESQLSCVLETLRQAGAE
INETNSGLRVVRNGHGIQPVDITTDPFPGFPTDLQAQFMGLMTRAKGTSHITETIFENRF
MHVQELARLGAKISLSGQTATVEGVERLKGAQVMATDLRASVSLVIAGLAAEGETIVNRV
YHLDRGFERLEEKLSRCGADVKRISG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcaaatcgattgccggacaaatgcttcggcccagaaggtgaacagcatggatcgc
attaaaatcgtcggcggcaacaagctcaacggcgtcattcccatttccggcgctaaaaac
gctgcccttcccctgatgatcgcctcgcttctcaccgacgatacgctcacgctggaaaac
gtgccccatctggccgatgtcgagcaattgatccgcatcctgagcaatcatggcgtcgat
tattccgtgaacggacgtcgcgaacaccagaacggcccctattcccgcacgatccatttc
accgcccgcaatatcgtggacacgaccgcgccttatgagctcgtttccaggatgcgcgcc
agcttctgggttatcggtccgcttctcgcccgcatgggtgaggccaatgtttcgctgccc
ggcggctgcgccatcggcacacgtcccgtggacctgctgcttgatgccctgctggcactc
ggcgcggaaatcgacattgaaaacggttatgccaaagccaaggccaggaacggccttgtc
ggcgcgcgctataaattccccaaggtttcggtcggcgccacgcatgtcatgctgatggcg
gcaacgctggccaagggcgaaaccatcattgaaaatgccgcacgcgaaccggaagtggca
aacctcgccgactgtctcaacgccatgggggcgaagatcagcggcgcgggcagcagcacg
atccatgttcaaggcgtcaccaatctttccggcgcgcgcgtgcgcatcatcccggaccgt
atcgaggcgggcacctatgccatggccgtggcaatgaccggcggcgatgttcttctggaa
ggtgcgcaggaaagccagctttcctgtgtgcttgaaacgctgcgccaggcaggcgctgaa
atcaacgagaccaatagcggcctgcgcgtggtgcgcaacgggcacggcatccagccggtc
gatatcaccaccgatcccttccccggcttcccgaccgatcttcaggcgcagttcatgggc
ctgatgacccgcgccaaaggcacctcgcacattaccgagaccatctttgaaaaccgcttc
atgcatgtgcaggaactggcgcgtctcggggcgaaaatctcgctctccggccagaccgca
accgtggagggcgtggaacgcctgaagggcgcgcaggtgatggcgacggacctgcgtgcc
tctgtttcgctggtgatcgcaggacttgcagccgaaggcgaaaccatcgtcaaccgcgtc
tatcaccttgatcgcggctttgaacggctggaggaaaagctttcgcgctgcggcgcggat
gtcaagcgtatcagcggctga

DBGET integrated database retrieval system