KEGG   Brucella abortus A13334: BAA13334_I00017Help
Entry
BAA13334_I00017   CDS       T01704                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
baa  Brucella abortus A13334
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:baa01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:baa00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:9384..10676
Genome map
AA seq 430 aa AA seqDB search
MVTTLRQTDPDFEQKFAAFLSGKREVSEDVDRAVREIVDRVRREGDSALLDYSRRFDRID
LEKTGIAVTEAEIDAAFDAAPASTVEALKLARDRIEKHHARQLPKDDRYTDALGVELGSR
WTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAARLAG
VSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGPSEVL
IVADKDNNPDWIAADLLAQAEHDMAAQSILMTNDEAFAHAVEEAVERQLHTLARTETASA
SWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTPEVIG
DYVGGCNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEGLDAH
AQSVAIRLNL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggtcacaacgctcagacagaccgaccctgattttgaacagaagtttgcggccttcctc
tccggcaagcgcgaggtttcggaagatgtggaccgcgccgtgcgggaaatcgtggatcgt
gtacgccgcgagggtgacagcgcgctgctcgattattcacgccgcttcgaccggatcgat
ctggaaaagaccggcattgccgtcaccgaggccgagatcgatgccgcattcgatgccgct
cccgcctccaccgtcgaagcattgaagcttgcgcgcgaccgtatcgaaaagcaccatgct
cgccagttgccgaaggacgaccgctatacggatgcgcttggcgtcgagcttggctcgcgc
tggacggccatcgaggctgtcggcctctatgtgcctggcggcacggccagctatccaagt
tccgttctgatgaatgcgatgcccgccaaggtcgcaggcgtggaccgcatcgtcatggtg
gtgcccgcacccgatggcaatctcaatccgctggtgctggtggcagcccgccttgcaggc
gtgtcggagatttaccgcgtcggcggcgcgcaggccattgccgcccttgcctatggcacc
gaaacgatccgtcccgtcgccaagatcgtcggccccggcaatgcctatgtggcagcggca
aagcgcatcgtattcggaacggtcggcatcgacatgatcgccgggccatccgaagtgctg
atcgtggccgacaaggacaataacccggactggatcgccgccgatcttctggcacaggcc
gagcacgatatggccgcgcaatccatcctgatgaccaatgacgaggcctttgcccacgcg
gtggaagaagcggtcgaacggcagcttcacaccctggcgcgcactgaaacggcttccgca
agctggcgcgatttcggtgcggtcattctggtcaaggatttcgaggacgcaattccgctt
gccaaccgtattgcggccgagcatctggaaatcgccgtggccgatgcggaggcgttcgta
ccgcgcatccgcaatgccggttccatattcattggcggttatacaccggaagtgatcggc
gattatgtggggggctgcaaccatgtgctgccaacggcgcgctctgcccgtttctcctcc
ggcctttcggtgctcgattatatgaagcgcacctcgcttctcaagctgggctccgagcag
cttcgcgcacttggaccggctgcgatcgagattgcacgcgccgagggtctcgatgcccat
gcccaatccgtcgccattcgtctgaacctatga

DBGET integrated database retrieval system