KEGG   Brucella abortus A13334: BAA13334_I00413Help
Entry
BAA13334_I00413   CDS       T01704                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
baa  Brucella abortus A13334
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:baa00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:baa02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(249138..249716)
Genome map
AA seq 192 aa AA seqDB search
MAFLATVFVVMTTGILSDSLFHSPAPEKPGFAIEVAQGSGGGESAAAPAKKEVSIATLLQ
SADPARGEVVFKRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSAAMKEFGAAGN
KWDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSDNPVPLPAADAAPAD
SDKKPAEAAPAN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcatttctggcaacggttttcgttgtcatgacgacgggcattctgtctgattcgctg
tttcattcgccggctcctgaaaagccgggctttgccatagaggtagcccaaggttcgggg
ggcggagaaagtgctgcggctcccgccaagaaagaagtttcaattgcaaccctgttgcaa
agtgccgatccggcgcgtggcgaagtggttttcaagcgttgccaggcttgccacaccggg
gacaagggcggggccaacaaggttggtccgcatctgtggggtgtcgtgggtcgcccggct
gcctccgttgaaggtttcagctattccgctgccatgaaggaattcggcgcggctggcaac
aagtgggattttgagcatctcaacaagttcctcacctcgccgaaaggcttcatcaagggt
acagccatgggctttgccggtgacaagaaggataatgagcgcgctgacctgattgcttat
ctgcgcacgctgtccgacaatccggtgccgctgccggccgcagacgcagcgcccgcagat
agcgataaaaagcccgccgaagctgcaccggccaattga

DBGET integrated database retrieval system