KEGG   Brucella abortus A13334: BAA13334_I00425Help
Entry
BAA13334_I00425   CDS       T01704                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
baa  Brucella abortus A13334
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:baa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BAA13334_I00425
DNA repair and recombination proteins [BR:baa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BAA13334_I00425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:255781..256386
Genome map
AA seq 201 aa AA seqDB search
MSKRIAGPEIERLIQLLARVPGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRIC
SCCGNVDTSDPCTICTDERRDPATLIVVEDVSDLWALERAGTMNVRYHVLGGRLSPLDGI
GPDDLNIKGLVERVASGAIKEVILAVNATVEGQTTAHYITDQLSNFDVRVTRLAHGVPVG
GELDYLDEGTLAAALRARTTL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgaatagccggtcctgaaatcgaacgtctgatccagcttctggcccgcgtg
ccggggctcggaccgcgctcggcccgccgtgcggcgctgcatctcatcaaaaagaaggaa
gcgcttctggtgccgcttggcggcgccatgcaggaggccgctgaaaaggtgcgcatctgt
tcgtgttgcggcaatgtcgatacgtccgacccgtgcacgatctgcaccgatgagcgccgc
gatccggcaactttgattgtcgtggaggatgtatccgatctctgggcgctggagcgggca
ggcacaatgaatgtgcgctatcatgtattgggtggccgcctgtcaccgctcgatggcatc
ggcccggacgatctcaacatcaaggggctggtggagcgggttgcaagcggcgccatcaag
gaagtgatcctcgcggtcaacgccactgtcgaaggccagacgaccgcccattacatcaca
gaccagctatcgaatttcgatgtgcgcgtgacacggcttgcccatggcgttcccgttggc
ggcgaacttgactatctggatgaaggcacgcttgctgctgcgttacgggcgcgaaccacg
ctttaa

DBGET integrated database retrieval system