KEGG   Brucella abortus A13334: BAA13334_I00477Help
Entry
BAA13334_I00477   CDS       T01704                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
baa  Brucella abortus A13334
Pathway
baa00071  Fatty acid degradation
baa00280  Valine, leucine and isoleucine degradation
baa00281  Geraniol degradation
baa00310  Lysine degradation
baa00360  Phenylalanine metabolism
baa00362  Benzoate degradation
baa00380  Tryptophan metabolism
baa00410  beta-Alanine metabolism
baa00627  Aminobenzoate degradation
baa00640  Propanoate metabolism
baa00650  Butanoate metabolism
baa00903  Limonene and pinene degradation
baa00930  Caprolactam degradation
baa01100  Metabolic pathways
baa01110  Biosynthesis of secondary metabolites
baa01120  Microbial metabolism in diverse environments
baa01130  Biosynthesis of antibiotics
baa01212  Fatty acid metabolism
Module
baa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BAA13334_I00477
   00650 Butanoate metabolism
    BAA13334_I00477
  Lipid metabolism
   00071 Fatty acid degradation
    BAA13334_I00477
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAA13334_I00477
   00310 Lysine degradation
    BAA13334_I00477
   00360 Phenylalanine metabolism
    BAA13334_I00477
   00380 Tryptophan metabolism
    BAA13334_I00477
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAA13334_I00477
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BAA13334_I00477
   00281 Geraniol degradation
    BAA13334_I00477
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAA13334_I00477
   00627 Aminobenzoate degradation
    BAA13334_I00477
   00930 Caprolactam degradation
    BAA13334_I00477
Enzymes [BR:baa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BAA13334_I00477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEW16670
Position
1:complement(294848..295621)
Genome map
AA seq 257 aa AA seqDB search
MAYETIIVETRDSVGLIRLNRPQALNALNRAVLEELTDALAAFDADGKVGAVVLTGSEKA
FAAGADIKEMQSINFVDAYLQDMFADWQKVDRIRKPIIAAVSGYALGGGCELAMMCDFII
AGSNAKFGQPEITLGVIPGMGGSQRLTRYVGKSKAMDMCLTGRMMDAAEAERCGLVSRVV
APEALLEEALKAAERIASFSRVSVYMAKEAVNRAYETTLDEGLRFERRLFHSLFATEDQK
EGMSAFVDKRTPSFKNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgaaacaatcatcgttgagacgcgtgacagcgttggtctcatccgtctcaac
cgtccgcaggcgctcaacgcgctcaatcgcgccgtgcttgaggagctgaccgatgcgctt
gccgccttcgacgcggatggcaaggtcggcgccgtggtgctgaccggctcggaaaaggct
ttcgccgccggggccgacatcaaggaaatgcagtcgatcaatttcgtcgatgcctatttg
caggacatgttcgccgactggcagaaggtggatcgtatccgcaagccgattatcgcggct
gtttcgggctatgcgctgggcggcggctgcgaactcgccatgatgtgcgatttcatcatc
gcgggcagcaatgcgaaattcggccagccggaaatcacgctgggcgtcattcctggcatg
ggcggctcgcagcgcctgacgcgctatgtcggcaagtccaaggctatggatatgtgcctg
acgggccgcatgatggatgcagccgaagcggagcgttgcggccttgtttcccgcgttgtc
gcaccggaggctcttctggaagaggcactgaaagcagccgaacgcatcgcatccttctcg
cgcgtctcggtctatatggccaaggaagcggtcaaccgcgcctatgaaacgacgctggac
gagggcctgcgtttcgagcgccgcctgttccattcgcttttcgcgaccgaagaccagaag
gaaggcatgtccgctttcgttgataaacgtaccccttccttcaagaaccgctga

DBGET integrated database retrieval system