KEGG   Brucella abortus A13334: BAA13334_I00947Help
Entry
BAA13334_I00947   CDS       T01704                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
baa  Brucella abortus A13334
Pathway
baa00020  Citrate cycle (TCA cycle)
baa00190  Oxidative phosphorylation
baa00650  Butanoate metabolism
baa01100  Metabolic pathways
baa01110  Biosynthesis of secondary metabolites
baa01120  Microbial metabolism in diverse environments
baa01130  Biosynthesis of antibiotics
baa01200  Carbon metabolism
Module
baa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
baa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
baa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAA13334_I00947
   00650 Butanoate metabolism
    BAA13334_I00947
  Energy metabolism
   00190 Oxidative phosphorylation
    BAA13334_I00947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Ribophorin_II
Motif
Other DBs
NCBI-ProteinID: AEW16953
Position
1:562226..562621
Genome map
AA seq 131 aa AA seqDB search
MNGMNNDMRIPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEV
RAALSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLAC
VFAILKLSFGG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatgaataacgatatgcgtattccgctcgggaaggttcgcggtctgggttcg
gcaaaagaaggcaccagccatttctggtatcagcgcctgagcgccgttgccctggtgccg
ctggttctgtttttcatcggcctggtcatttcgctcaatggcgcaagctatgcggaagtc
cgggctgccctgtcacatcccttcaccgctgtggtgatggcgctgtttgtcctcacgggc
gtttatcacatgcgcctgggtatgcaggttattattgaagattatgtgcatggcgaaggc
atgaagatcgtgctggtgatgctgaacaccttctttacggtggtggttggtcttgcctgc
gttttcgcgatcctcaagctcagctttggaggttga

DBGET integrated database retrieval system