KEGG   Brucella abortus A13334: BAA13334_I01033Help
Entry
BAA13334_I01033   CDS       T01704                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
baa  Brucella abortus A13334
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:baa01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:baa00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:624709..625845
Genome map
AA seq 378 aa AA seqDB search
MLKKLKDYRRIVVKIGSALLVDRATGLKRKWLESLGQDIAALQHAGVEVLVVSSGAIALG
RTVLGLPKKALKLEESQAAAAAGQIALAKAYADVLGGHGIKSGQILVTLSDTEERRRYLN
ARATIETLLKLKAVPIINENDTVATTEIRYGDNDRLAARVATMMGADLLILLSDIDGLYT
APPHKNPDAQFLPFVETITPQIEAMAGAAASELSRGGMKTKLDAGKIANAAGTAMIITSG
TRFGPLSAIDRGERATLFEAAHAPVNAWKTWISGNLEPAGRLTVDAGAVKALKSGKSLLP
AGVKEVDGDFERGDTVAVMNEDGREIARGLIAYDAADARKVAGHKSDEISAILGYDARAA
MIHRNDLVVRAASDAKAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaactgaaagactatcgccgcatcgttgttaaaataggctctgcccttctg
gtggaccgggccacaggcctgaagcgtaaatggctggaaagcctggggcaggatattgcc
gccttgcagcatgcgggcgttgaggtgctggtggtttcgtcgggtgcaattgcactgggg
cgcacggttctgggcctgccgaaaaaggcgctgaagcttgaggaaagccaggcggcggca
gcagccgggcagattgcgctggcgaaggcttatgcggatgtgctgggcggacatggcatc
aagtcgggacagattctggtcacgctttccgatacggaagagcgccgccgctatctcaat
gcgcgcgcaaccatcgagaccctgctgaagctcaaggccgtgccgatcatcaatgaaaac
gatacggtggcaaccaccgaaatccgttatggcgacaatgacaggttggcggcgcgcgtc
gcgaccatgatgggcgcggaccttctgatcctgctttccgacattgacgggctttatacc
gcgccgccgcacaagaatccggatgcgcaatttctgccctttgtcgaaaccatcacgccg
cagatcgaagccatggcgggggcggcagcatccgagctttcgcggggtggcatgaagacc
aagctcgatgcgggcaagattgcaaacgctgccgggaccgcgatgattatcacttcgggc
acgcgtttcggcccgctttcggcaattgaccgaggggagcgtgcgacattgttcgaggct
gcccatgcgccggtcaatgcgtggaagacgtggatttccggcaatctggaaccggctggc
cggttgactgtggatgcgggtgctgtcaaggcgctcaaatccggcaaatcgcttttgcct
gcgggcgtgaaggaagttgacggggatttcgagcgtggcgacacggttgccgtcatgaac
gaggatgggcgggagattgcgcgcggtctgatcgcctatgatgctgctgacgcccgcaag
gttgccgggcataaaagcgatgagatcagtgccattcttggctatgatgcccgcgcggcg
atgatccatcgcaacgatctggtggtgcgggccgccagcgatgcgaaagccgcatag

DBGET integrated database retrieval system