KEGG   Brucella abortus A13334: BAA13334_I01258Help
Entry
BAA13334_I01258   CDS       T01704                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
baa  Brucella abortus A13334
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:baa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BAA13334_I01258
Enzymes [BR:baa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BAA13334_I01258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:753828..754445
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGVIDEIAEDHAVIDVHGVGYVAFCSARTLGNLGGAGEAAILFIETYVREDMIRL
YGFATQLEREWFRLLQNVQGVGAKVALAVLGTLSPSELANAIALRDIAMVSRAPGVGKKV
AERIVTELKNKAPAFAGEASGTIGLKQELGAGAAPAPVADAVSALSNLGYSRDQAANAVA
AALKETGEGADSAKLIRLGLKELSQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagttgaagggcgtgattgacgaaattgccgaggaccatgctgtcatcgac
gtgcatggcgtgggctatgtcgcgttttgttcggcgcgcacgctgggcaatctcggtggc
gcgggcgaggcggccatcctgttcatcgaaacctatgtccgtgaagatatgatccgcctt
tatggatttgccacgcagcttgagcgcgaatggttccgcctgttgcagaatgtgcaaggg
gtgggggccaaggtggctttggcggtgcttggcaccctgtcgccgtccgaacttgccaat
gcgattgcgctgcgcgacattgccatggtttcgcgcgcgccgggcgtcggcaagaaagtg
gcagagcgtatcgttaccgaattgaagaacaaggctcccgcctttgccggtgaggcgagc
ggcacgatcgggctcaagcaggagcttggcgcaggtgcggcgcctgcacccgttgccgat
gcggtttcggcgctttccaacctcggttattcgcgcgatcaggccgccaatgccgtggca
gccgccttgaaggaaacgggcgagggcgccgattcggccaagctgatacggctcggtttg
aaggaactctcgcagtga

DBGET integrated database retrieval system