KEGG   Brucella abortus A13334: BAA13334_I01348Help
Entry
BAA13334_I01348   CDS       T01704                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
baa  Brucella abortus A13334
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAA13334_I01348
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAA13334_I01348
   00630 Glyoxylate and dicarboxylate metabolism
    BAA13334_I01348
Enzymes [BR:baa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BAA13334_I01348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1:complement(800936..803122)
Genome map
AA seq 728 aa AA seqDB search
MGSAEKRNYVEIEGLAVAPELVEFLAKEAAPGTGVEPEKFWKGFAAIIRDLTPKNRALLA
KRDELQARIDAWYKENRDKGYSQADYQQFLKDIGYLLPEGGAFSVSTTNVDPEITHIAGP
QLVVPVMNARYALNAANARWGSLYDALYGTDAISEADGAEKGKGYNPKRGEKVIAWAKNF
LDESAPLSTGKWADVAGLAVNDGKLEIRLTDGSATTLKDESQFKGYNGDAASPTNVLLAK
HNMHVDIVINADHPIGKTDPAHIADVVLESAISTIQDCEDSIAVVDAEDKVAVYRNWLGL
MNGKLEDTFEKNGKQMTRRLNGDRTYTAPDGSTLTLKGRSLMLVRNVGHLMTNPAILDAE
GNEVPEGIMDAAFTSLIALHDIGPNGRHMNSREGSVYIVKPKMHGPEEVAFANEIFTRTE
EMLGMKPNTLKIGIMDEERRTTVNLKEAIRAAKDRVVFINTGFLDRTGDEIHTSMEAGPM
IRKGDMKQAAWIGAYEQWNVDIGLECGLSGHAQIGKGMWAMPDMMAAMLEQKIAHPKAGA
NTAWVPSPTAATLHATHYHKIDVAAVQEKLKSRPRAKLDDILSVPVAVRPNWTPDDIQHE
IDNNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISAQHIANWLYHGVVSEAQ
VMETMKRMAAIVDKQNEGDPLYRPMAADFDKSIAFQAACDLVFKGREQPNGYTEPVLHRR
RLELKQAS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcgcagaaaaacgtaactatgtcgagattgaaggcttggctgttgcccctgag
cttgtggaatttctggccaaagaagccgcgcccggcacaggcgtggagccggagaaattc
tggaagggctttgccgccatcattcgcgatctcacaccaaagaaccgcgccctgctcgcc
aagcgtgacgagcttcaggccaggatcgacgcctggtacaaggaaaaccgcgacaagggc
tacagccaggccgattaccagcagtttctgaaagatatcggctatctcctgccggaaggt
ggagcgttttcggtttcgaccaccaatgtcgatcctgaaatcacccatattgccggtccg
cagcttgtcgtcccggtcatgaatgcgcgctatgcactcaacgccgccaatgcgcgctgg
ggctcgctctatgatgcgctttatggcaccgacgcgatttccgaggccgatggcgcggaa
aagggcaagggctacaatccgaagcgcggtgaaaaggttattgcgtgggcgaagaatttc
ctcgatgaaagcgcaccgctcagcacgggcaaatgggccgatgttgccggtctcgccgtg
aacgacggcaagcttgaaatcaggctgaccgatggttcggcaaccaccttgaaggacgaa
agccagttcaagggctataatggcgatgccgccagcccaacgaatgtgcttcttgccaag
cacaatatgcatgttgatatcgtcatcaatgcagatcacccgatcggcaagaccgatccg
gcgcatattgccgatgtggttctggaatcggccatcagcacgatccaggattgtgaggac
tccattgccgtcgtcgatgccgaagacaaggttgccgtctatcgcaactggctcggcctg
atgaatggcaagctggaagacacgttcgagaagaacggcaagcagatgacgcgccgcctc
aatggcgaccgcacctacacggcgccggacggttccacgctgacgctcaagggccgttcc
ttgatgctggtgcgcaatgtcggccacctgatgaccaacccggccattctggacgccgaa
ggcaatgaagtgccggaaggcatcatggatgcagccttcaccagcctgattgcgctgcat
gatatcggccccaatggccgccacatgaattcgcgcgaaggctcggtctatatcgtcaag
ccaaaaatgcatgggccggaagaagtggcattcgcaaatgaaatcttcacccggaccgaa
gaaatgctcggcatgaagccgaatacgctcaaaatcggcatcatggacgaagaacgccgc
acgaccgtcaatctcaaggaggcaatccgcgccgccaaggatcgcgtcgtcttcatcaat
accggcttcctcgaccgcacgggcgacgagatccacacctccatggaagcaggcccgatg
atccgcaagggcgacatgaagcaggctgcgtggatcggcgcctatgaacaatggaatgtc
gatatcggtctggaatgcgggctttccggccatgcgcagatcggcaagggcatgtgggcc
atgcccgacatgatggcggcaatgctggagcagaagatcgcgcatccgaaggccggtgcg
aacaccgcctgggtgccgtcgccgaccgccgccaccttgcacgctacccattaccacaag
atcgatgtagccgccgttcaggaaaagctgaaaagccgtccccgcgccaagctggacgat
atcctgtcggtgccggttgcggtgcgtccgaactggacgccggacgatatccagcacgaa
atcgacaacaatgcacaaggcattctcggctatgtcgtgcgctggatcgatcagggtgtc
ggctgctccaaggtgccggacatcaacaatgtcggcctgatggaagatcgcgcgacgctg
cgcatttccgcgcagcacatcgccaactggctttatcatggcgtcgtgtcagaggcacag
gtgatggaaaccatgaagcgcatggcagccatcgtcgacaagcagaacgaaggcgacccg
ctttatcgcccgatggccgctgattttgacaagtcgattgccttccaggcggcttgcgat
ctggtcttcaagggccgcgaacagccgaacggctacaccgagccggtcctgcatcgccgc
cggctcgaactgaaacaggcttcctga

DBGET integrated database retrieval system