KEGG   Brucella abortus A13334: BAA13334_I01804Help
Entry
BAA13334_I01804   CDS       T01704                                 

Definition
urease subunit alpha 2
Orthology
K01428  
urease subunit alpha [EC:3.5.1.5]
Organism
baa  Brucella abortus A13334
Pathway
Purine metabolism
Arginine and proline metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BAA13334_I01804
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BAA13334_I01804
  Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    BAA13334_I01804
Enzymes [BR:baa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     BAA13334_I01804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1080532..1082253)
Genome map
AA seq 573 aa AA seqDB search
MTQISRQQYADLYGPTIGDKIRLGDSDLYVEIEKDLRATYGDELQYGGGKTLRDGMGSEN
FLTQEAGCLDLVITNVTVIDAIQGVVKADVGIRNGRIVGLGKAGNPSTKDGVTRGLVTGA
STDAISGEHLILTAGGMDTHVHYIAPQQVEAALSNGITTLWGGGIGPVDGTNGVTTTNGP
WNLEMMLRSIEGLPINFGIQGKGNSTGIAPLIEQLEAGAAGFKVHEDYGATPATIRACLS
VADEYDVSVAVHTDTLNESGYVEDTIAAFDGRSVHTYHSEGAGGGHAPDLLKVVGQNNIL
PSSTNPTLPCGKNSVAELFDMIMVCHNLNPKIPSDVAFAESRVRAETIVAESVLHDMGAI
SMIGSDSQAMGRLGETFLRAIQTADAMKKARGPLPEDAPGNDNFRVLRYIAKVTINPALT
AGVGDVIGSIESGKFADLVLWEPAFFGVKPKLVLKGGLVAWANMGDPNASLPTPQPMYYR
PMFAAYGSALQKTSITFVSRAAYDKGVADRFGLQRLVMPVSGTRVIGKAHMVRNSYLPNI
EVDPQTFAVKVDGVHATVKPPQSISLNQLYFFS
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgacacagatttcccgccagcaatacgccgacctttatggcccgacaattggggacaag
ataaggcttggcgactccgatctttacgttgaaatcgagaaggatctgcgcgccacttat
ggcgacgaactgcaatatggtggcggaaaaacgctgcgtgacggcatggggtcggaaaat
ttccttacccaggaagcaggctgcctcgatctggtcattacaaatgtgactgtcatcgac
gccatacagggggttgtgaaggccgatgtcggcattcgcaacggaaggatcgtcggcctt
ggaaaagcaggcaacccttccaccaaggacggtgtgacgcgcggccttgtgaccggcgct
tcaaccgacgccatatcgggcgagcaccttatcctcaccgcgggcggcatggatacccat
gttcactatatcgcgccgcagcaggtggaggccgctctctcgaacggcatcaccacgctc
tggggcggcggcatcgggccggttgacggcacaaacggcgtgaccacgaccaacgggccg
tggaatctcgaaatgatgctgcgctccatcgagggcctgccgatcaactttggcattcag
ggcaagggaaattccaccggcattgcgcctctgatcgagcagctggaagcaggtgccgcc
ggtttcaaggtccatgaagactatggcgccacgccggctacaattcgcgcctgcctttcg
gttgccgatgaatatgacgtgtcggtggccgtccatacggatacgctgaacgaatccggc
tatgtcgaggacaccatcgcagccttcgacgggcgctccgtccacacctatcacagcgaa
ggcgcaggcggcggtcacgcgccggatctgctgaaagtggtgggccagaataacatcctg
ccaagctcgaccaatccgacattgccctgcggcaagaactcggtcgccgaactctttgat
atgattatggtatgccataatctcaatccgaaaatcccttccgacgtcgcctttgccgaa
agccgtgtccgcgccgaaaccatcgtcgccgaaagcgtgctgcatgacatgggtgcgatc
tcgatgatcggctcggattcgcaggccatgggccgcctcggcgaaaccttccttcgcgcc
atacaaactgcggacgccatgaaaaaggcgcgcggtccgctgccggaggatgcgcccgga
aacgacaatttccgcgtgctgcgctatattgcgaaagtgaccatcaatccggcgctgacc
gccggtgtcggcgatgtaatcggctcgatagagtccggcaaattcgcagatctggtgctt
tgggaaccggccttcttcggcgtcaagccgaagctcgtcctcaagggcggactggtggca
tgggccaatatgggcgacccgaacgcatcattgccgacgccgcagcccatgtattaccgc
cccatgttcgcagcctatggttctgcgctccagaagacctccatcaccttcgtttcgcgc
gcggcctacgacaagggtgtcgccgaccgcttcggcttgcagcggctggtaatgcccgtc
tccggaacccgcgtcatcggcaaggcccacatggttcgcaacagctatctgccgaatatc
gaagtcgatccgcagactttcgcggtcaaggtcgatggcgtccacgcaacggtgaagccg
ccacagtcgatctcgctcaaccagctttatttctttagctga

DBGET integrated database retrieval system