KEGG   Brucella abortus A13334: BAA13334_I02173Help
Entry
BAA13334_I02173   CDS       T01704                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
baa  Brucella abortus A13334
Pathway
baa00010  Glycolysis / Gluconeogenesis
baa00020  Citrate cycle (TCA cycle)
baa00620  Pyruvate metabolism
baa01100  Metabolic pathways
baa01110  Biosynthesis of secondary metabolites
baa01120  Microbial metabolism in diverse environments
baa01130  Biosynthesis of antibiotics
baa01200  Carbon metabolism
Module
baa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAA13334_I02173
   00020 Citrate cycle (TCA cycle)
    BAA13334_I02173
   00620 Pyruvate metabolism
    BAA13334_I02173
Enzymes [BR:baa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAA13334_I02173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N DUF4772 ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AEW17719
Position
1:1295171..1296514
Genome map
AA seq 447 aa AA seqDB search
MPINITMPALSPTMEEGNLSKWLVKEGDKVAPGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAEEGEDLAAAAKGAGAAPKAEAPKEEPKPAEAKKEAAAPAAAP
APARSEQPAVAPAVNKGERVFASPLARRIAKDAGVDISAVKGSGPHGRVIQRDVEAALAS
GGAKAVSAQAESAAAPKPMSDDAILKLFEDGSYEVVPHDGMRKTIARRLVESKQTVPHFY
LTIDCELDALLALRSQINAAAPMLKTEKGEVPAYKLSVNDMVIKATALALRDVPEANVSW
TEGGMIKHKCSDVGVAVSIPGGLITPIVRHAESKTLSVISNEMKDMARRARDRKLKPEEY
QGGSTSVSNLGMFGVKDFAAIINPPHATIFAIGAGEERAVVKKGEIKVATVMSVTLSTDH
RAVDGALAAELAQAFKRHIENPMGMLV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcaccatgccagcgctttctcccacgatggaagaaggtaacctgtcg
aaatggctggtcaaggaaggcgataaggtcgctcccggcgatgttattgccgaaatcgaa
accgacaaggccacgatggaagtcgaggcggtggacgagggaacggtcgccaagatcgtc
gttccggctggcactgaaggcgtcaaggttaatgcgctgatcgctgttcttgccgaagaa
ggtgaggatctggcggctgcggccaagggcgctggcgcggctcccaaggcagaagcgccg
aaggaagagccgaagcctgctgaagcgaaaaaggaagctgcggctcctgccgctgcaccg
gctccagccaggagcgagcagcctgctgttgcgcctgccgtaaacaagggcgagcgcgtg
ttcgcctcaccgcttgcgcgccgtatcgccaaggatgcaggcgtcgatatttctgccgtg
aagggctccggcccgcatggccgcgtgattcagcgcgatgtggaagctgctctggcttcc
ggcggtgccaaggccgtttcggcacaggccgaatctgctgccgcgccgaagccgatgtcg
gatgatgccattctcaaactcttcgaggacggctcctacgaggtcgtgccgcatgacggt
atgcgcaagacaattgcccgccgtctggtggaatcgaagcagactgttccgcatttctat
ctgacgatcgattgcgaactggatgcgcttctggcgctgcgttcgcagatcaatgctgcg
gccccgatgctcaagacggaaaagggcgaggttccggcctacaagctttccgtcaacgac
atggttatcaaggcgacggcgctggcgctgcgtgacgtgccggaggcgaatgtttcctgg
accgagggcggcatgatcaagcacaagtgttcggatgtgggggttgccgtttccattccg
ggcggcctgattacgcctatcgtccgccacgcggaatcgaagacgctctccgttatctcg
aacgagatgaaggatatggccagacgcgcgcgtgaccgcaagctgaagcctgaggaatat
cagggtggctcgacctccgtgtcaaacctcggcatgttcggcgtcaaggatttcgccgcg
atcatcaatccgccacatgcaaccattttcgcaattggtgcaggcgaggagcgcgccgtg
gtcaagaagggggaaataaaggtagcgactgtcatgtctgttacactttccaccgatcat
cgcgctgtcgatggtgcgcttgccgcagaacttgcgcaggcattcaagcgccatatcgaa
aacccgatgggtatgctggtctga

DBGET integrated database retrieval system