KEGG   Brucella abortus A13334: BAA13334_I02281Help
Entry
BAA13334_I02281   CDS       T01704                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
baa  Brucella abortus A13334
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:baa01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:baa00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:baa00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:baa00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:baa00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:baa00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1366988..1367752
Genome map
AA seq 254 aa AA seqDB search
MKAMVLEKPGQPLVLVERPDPLPGPGQIRLKVEACAVCRTDLHVVDGELERPKLPLVPGH
EIVGVIDAVGTGVDPSRTGRRVGVPWLGHTCGACDYCRSGAENLCDAPLFTGYTRDGGFA
THVVADADFAFDLDEAADPVALAPLLCAGLIGWRSLKKAGEGKRIGLYGFGAAAHIIAQV
CRWQTGRFTLSQSPEIRKRKILRAALARYGPEIQIFCRRHRWMQLSFSHPPGSSFQPPCV
RCARAAGWSAAASI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatggtgctggagaagccgggacagccactggttctcgtggagcgccctgat
ccgttgccggggccgggccagatcaggctgaaggttgaagcctgcgccgtctgccggaca
gatttgcatgtggtggatggagagcttgaaaggccaaagctgccgctggttcccggacat
gagatcgttggcgttatcgatgccgttggaacgggcgtcgatccgtcacgcacaggacgg
cgtgtgggggttccgtggcttgggcatacttgcggcgcctgtgactattgtcgctccggc
gctgaaaacctgtgcgatgccccgctttttaccggctacacgcgcgatggcgggttcgcc
acccatgtcgtcgcagatgccgattttgctttcgatctcgatgaggccgccgatcctgtg
gctctggcgcccttgctctgcgctgggctgatcggctggcgatcgctgaagaaagcaggc
gagggcaagcgcatcggcctttatggctttggggctgccgcacacatcattgcgcaggtc
tgccgctggcagacagggaggtttacgctttcacaaagcccggagatacggaagcgaaag
attttgcgcgcagccttggcgcggtatgggccggagattcagatattctgccgccgtcac
cgctggatgcagctatcattttcgcacccgccggggagctcgttccagccgccttgcgtg
cggtgcgcaagggcggccgggtggtctgcggcggcatccatatga

DBGET integrated database retrieval system