KEGG   Brucella abortus A13334: BAA13334_I02281Help
Entry
BAA13334_I02281   CDS       T01704                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
baa  Brucella abortus A13334
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BAA13334_I02281
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAA13334_I02281
  Lipid metabolism
   00071 Fatty acid degradation
    BAA13334_I02281
  Amino acid metabolism
   00350 Tyrosine metabolism
    BAA13334_I02281
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAA13334_I02281
   00626 Naphthalene degradation
    BAA13334_I02281
Enzymes [BR:baa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAA13334_I02281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1366988..1367752
Genome map
AA seq 254 aa AA seqDB search
MKAMVLEKPGQPLVLVERPDPLPGPGQIRLKVEACAVCRTDLHVVDGELERPKLPLVPGH
EIVGVIDAVGTGVDPSRTGRRVGVPWLGHTCGACDYCRSGAENLCDAPLFTGYTRDGGFA
THVVADADFAFDLDEAADPVALAPLLCAGLIGWRSLKKAGEGKRIGLYGFGAAAHIIAQV
CRWQTGRFTLSQSPEIRKRKILRAALARYGPEIQIFCRRHRWMQLSFSHPPGSSFQPPCV
RCARAAGWSAAASI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatggtgctggagaagccgggacagccactggttctcgtggagcgccctgat
ccgttgccggggccgggccagatcaggctgaaggttgaagcctgcgccgtctgccggaca
gatttgcatgtggtggatggagagcttgaaaggccaaagctgccgctggttcccggacat
gagatcgttggcgttatcgatgccgttggaacgggcgtcgatccgtcacgcacaggacgg
cgtgtgggggttccgtggcttgggcatacttgcggcgcctgtgactattgtcgctccggc
gctgaaaacctgtgcgatgccccgctttttaccggctacacgcgcgatggcgggttcgcc
acccatgtcgtcgcagatgccgattttgctttcgatctcgatgaggccgccgatcctgtg
gctctggcgcccttgctctgcgctgggctgatcggctggcgatcgctgaagaaagcaggc
gagggcaagcgcatcggcctttatggctttggggctgccgcacacatcattgcgcaggtc
tgccgctggcagacagggaggtttacgctttcacaaagcccggagatacggaagcgaaag
attttgcgcgcagccttggcgcggtatgggccggagattcagatattctgccgccgtcac
cgctggatgcagctatcattttcgcacccgccggggagctcgttccagccgccttgcgtg
cggtgcgcaagggcggccgggtggtctgcggcggcatccatatga

DBGET integrated database retrieval system